| Clone Name | basd0h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TIP1_ARATH (Q52T38) Palmitoyltransferase TIP1 (EC 2.3.1.-) (Anky... | 48 | 6e-06 | 2 | PTM3C_BUCAI (P57635) PTS system mannitol-specific EIICBA compone... | 30 | 2.4 |
|---|
>TIP1_ARATH (Q52T38) Palmitoyltransferase TIP1 (EC 2.3.1.-) (Ankyrin| repeat-containing S-palmitoyltransferase) (Protein TIP GROWTH DEFECTIVE1) Length = 620 Score = 48.1 bits (113), Expect = 6e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +2 Query: 5 RSGLTPAQLAADKSHRQVAFYLGNARKVHSTR 100 ++GLTPAQLAA+K+HRQV+F+LGNAR + R Sbjct: 231 KTGLTPAQLAAEKNHRQVSFFLGNARSLLEKR 262
>PTM3C_BUCAI (P57635) PTS system mannitol-specific EIICBA component (EIICBA-Mtl)| (EII-Mtl) [Includes: Mannitol permease IIC component (PTS system mannitol-specific EIIC component); Mannitol-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (P Length = 632 Score = 29.6 bits (65), Expect = 2.4 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -2 Query: 121 LSKLGLAPRAMHFSSIPKVKCNLPVTLISSKL 26 LS L + P+ ++FS+I V C+ V+ ISS + Sbjct: 301 LSILAMTPKGLYFSNIISVACSFLVSFISSSI 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,829,778 Number of Sequences: 219361 Number of extensions: 337975 Number of successful extensions: 804 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)