| Clone Name | rbasd27p04 |
|---|---|
| Clone Library Name | barley_pub |
>NXL1_LATSE (P01379) Long neurotoxin 1 precursor (Neurotoxin alpha) (Component| LSIII) Length = 87 Score = 30.8 bits (68), Expect = 1.8 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 115 TNRCARNTHFWQICTLKPSYIYTKAWCGSW 204 T C N H Q C Y K+WC +W Sbjct: 21 TRECYLNPHDTQTCPSGQEICYVKSWCNAW 50
>VSN1_NOCAE (P50186) NaeI very-short-patch-repair endonuclease (EC 3.1.-.-)| (V.NaeI) Length = 166 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 172 RKVLVYIFARNGYFWHTCWFHG*WVEGVNSVPEWWWNFXISR 47 RKV V+I +G FWH C HG + EW+W+ + R Sbjct: 80 RKVAVFI---DGCFWHVCPDHG----RQPTTNEWYWSPKLRR 114
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 29.3 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 59 EVPPPLRHTIYTFNPSPMEPTGVPEIPISGKYVH*NLPIYTRRRGVDR 202 EV P LR I T P P EP VP P + +P+ +RR + R Sbjct: 558 EVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLPEKRRSILR 605
>ALPS_TACTR (P07087) Anti-lipopolysaccharide factor (anti-LPS)| Length = 102 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 184 KAWCGSWRDITSKASKSS 237 K WC SW IT +A+KSS Sbjct: 50 KFWCPSWTSITGRATKSS 67
>ALPS_LIMPO (P07086) Anti-lipopolysaccharide factor (anti-LPS) (LALF)| Length = 101 Score = 29.3 bits (64), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 184 KAWCGSWRDITSKASKSS 237 K WC SW IT +A+KSS Sbjct: 49 KFWCPSWTSITGRATKSS 66
>EBNA2_EBV (P12978) Epstein-Barr nuclear antigen 2 (EBV nuclear antigen 2)| (EBNA-2) Length = 487 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 29 LTHRSSATDXEVPPPLRHTI-YTFNPSPMEPTGVP 130 LTH+S+ D + P P T+ Y P P+ P+ +P Sbjct: 262 LTHQSTPNDPDSPEPRSPTVFYNIPPMPLPPSQLP 296
>EBNA2_EBVG (Q3KSV2) Epstein-Barr nuclear antigen 2 (EBV nuclear antigen 2)| (EBNA-2) (EBNA2) Length = 451 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 29 LTHRSSATDXEVPPPLRHTI-YTFNPSPMEPTGVP 130 LTH+S+ D + P P T+ Y P P+ P+ +P Sbjct: 228 LTHQSTPNDPDSPEPRSPTVFYNIPPMPLPPSQLP 262
>VGLC_MEHVH (P18535) Glycoprotein A precursor (A antigen)| Length = 489 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +2 Query: 80 HTIYTFNPSPMEPTGVP--EIPIS 145 H I TFNPSP+ GVP E+P S Sbjct: 40 HHILTFNPSPISADGVPLSEVPNS 63
>VGLC_MEHVF (P13374) Glycoprotein A precursor (A antigen)| Length = 373 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +2 Query: 80 HTIYTFNPSPMEPTGVP--EIPIS 145 H I TFNPSP+ GVP E+P S Sbjct: 39 HHILTFNPSPISADGVPLSEVPNS 62
>TRPC2_MOUSE (Q9R244) Short transient receptor potential channel 2 (TrpC2)| (mTrp2) Length = 1172 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -2 Query: 208 LSTIHTTPSCIYRKVLVYIFARNGYFWHTCWFHG*WVEGVNSVPEWWWNF 59 LST ++ L I+ G+ W C W+EG+ S WWNF Sbjct: 690 LSTFKGRSQSVWETSLHMIWV-TGFLWFEC--KEVWIEGLRSYLLDWWNF 736
>TRPC2_RAT (Q9R283) Short transient receptor potential channel 2 (TrpC2)| (rTRP2) Length = 885 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -2 Query: 208 LSTIHTTPSCIYRKVLVYIFARNGYFWHTCWFHG*WVEGVNSVPEWWWNF 59 LST ++ L I+ G+ W C W+EG+ S WWNF Sbjct: 406 LSTFKGRSQSVWETSLHMIWV-TGFLWFEC--KEVWIEGLRSYLLDWWNF 452 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,325,256 Number of Sequences: 219361 Number of extensions: 1337842 Number of successful extensions: 2993 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2991 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)