| Clone Name | rbasd27g23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_GBVB (Q69422) Genome polyprotein [Contains: Core protein; E... | 30 | 3.1 | 2 | CAC1S_RANCA (O57483) Voltage-dependent L-type calcium channel al... | 29 | 6.9 | 3 | COQ5_MOUSE (Q9CXI0) Ubiquinone biosynthesis methyltransferase CO... | 28 | 9.1 |
|---|
>POLG_GBVB (Q69422) Genome polyprotein [Contains: Core protein; Envelope| glycoprotein E1; Envelope glycoprotein E2 (NS1); p13; Protease NS2-3 (EC 3.4.22.-); Serine protease/NTPase/helicase NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.1.-) (Hepacivirin) (NS3P) Length = 2864 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 345 GCSSRADWLGQLC*XMLCXWVLKVLALYFNSYSLIN*SIP 226 G + A W+G L C WV +VLA++F L +P Sbjct: 2672 GYNPSAAWIGYLIHHYPCLWVSRVLAVHFMEQMLFEDKLP 2711
>CAC1S_RANCA (O57483) Voltage-dependent L-type calcium channel alpha-1S subunit| (Voltage-gated calcium channel alpha subunit Cav1.1) (FGalpha1S) Length = 1688 Score = 28.9 bits (63), Expect = 6.9 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -3 Query: 392 DGSATCTGXKGXMGIXAALHGPIGWG--NCASXCSVXGCSKYWPSTSTVTASLTDRFR 225 D CTG M + + + P+G C + ++YW S + + ASL + R Sbjct: 499 DSFVVCTGLLEVMLVASDIMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVR 556
>COQ5_MOUSE (Q9CXI0) Ubiquinone biosynthesis methyltransferase COQ5,| mitochondrial precursor (EC 2.1.1.-) Length = 327 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 323 GWGNCASXCSVXGCSKYWPSTSTVTASLTDRFR 225 GW C + GC + WP + T SL+ R Sbjct: 16 GWWRATGHCRLPGCHRSWPWATLGTRSLSQEKR 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,320,924 Number of Sequences: 219361 Number of extensions: 692324 Number of successful extensions: 1492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)