| Clone Name | rbasd27e23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SMK1_YEAST (P41808) Sporulation-specific mitogen-activated prote... | 32 | 1.9 | 2 | SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Se... | 30 | 7.2 | 3 | YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39... | 30 | 9.4 |
|---|
>SMK1_YEAST (P41808) Sporulation-specific mitogen-activated protein kinase SMK1| (EC 2.7.11.24) (MAP kinase SMK1) Length = 388 Score = 32.0 bits (71), Expect = 1.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 310 MTKYSCLMKWIVGKCSSSPILDLIPWSPIF 221 + K+ + W +GK S++P+ IPWS IF Sbjct: 274 LIKFGTIKAWNLGKNSNNPVYKKIPWSNIF 303
>SEPP1_RAT (P25236) Selenoprotein P precursor (SeP) [Contains: Selenoprotein| Se-P10; Selenoprotein Se-P6; Selenoprotein Se-P2; Selenoprotein Se-P1] Length = 385 Score = 30.0 bits (66), Expect = 7.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 624 NLPSSSLHIHCHHHRLDGEQMQQTIE 701 +LP S LH H HHH+ G+ Q +E Sbjct: 237 SLPPSGLHHHHHHHKHKGQHRQGHLE 262
>YME7_YEAST (Q04705) Hypothetical 41.4 kDa protein in GAL80-PRP39 intergenic| region Length = 352 Score = 29.6 bits (65), Expect = 9.4 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 7/55 (12%) Frame = -3 Query: 646 WRELLGRLFLHHALAPVLMSGSLICLKGVYIWQDVI-------RTVSTNYQSGFS 503 W + + FL ++ L SG ++C + IW+ VI + +++NY +G S Sbjct: 60 WSNNIIQPFLEFRISKWLFSGCILCSSLILIWELVIGLRVYRKKEITSNYMNGIS 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,366,216 Number of Sequences: 219361 Number of extensions: 2203952 Number of successful extensions: 6139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6133 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7139613222 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)