| Clone Name | rbasd27e18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMW5_YEAST (Q04779) Hypothetical 78.8 kDa protein in ABF2-CHL12 ... | 31 | 4.1 | 2 | BLM_CHICK (Q9I920) Bloom syndrome protein homolog (EC 3.6.1.-) (... | 30 | 7.0 | 3 | C90B1_ARATH (O64989) Cytochrome P450 90B1 (EC 1.14.-.-) (Steroid... | 30 | 7.0 |
|---|
>YMW5_YEAST (Q04779) Hypothetical 78.8 kDa protein in ABF2-CHL12 intergenic| region Length = 684 Score = 30.8 bits (68), Expect = 4.1 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +3 Query: 510 TKCFKK--HCQSDDSLDINVWHSHPNAGRRLLHKEVELWLQRL 632 TK +KK HCQ D+S++ VW +RL++K+ +L+ + L Sbjct: 472 TKVYKKIHHCQEDNSVNYKVWKK-----QRLINKKNQLYYEPL 509
>BLM_CHICK (Q9I920) Bloom syndrome protein homolog (EC 3.6.1.-) (Fragment)| Length = 1142 Score = 30.0 bits (66), Expect = 7.0 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +3 Query: 441 CYECQVNKQYDRSKGATDEEKETTKCFKKHCQSDDSLDINVWHSHPNAGRRLLHKEVELW 620 C C K Y +S+ TDE K + ++HC ++ N + +GR L+ V+++ Sbjct: 793 CDNCSTKKDY-KSRNVTDEVKSIIRFVQQHCGQMGGINGN---RNTGSGRYTLNMMVDIF 848 Query: 621 L 623 L Sbjct: 849 L 849
>C90B1_ARATH (O64989) Cytochrome P450 90B1 (EC 1.14.-.-) (Steroid| 22-alpha-hydroxylase) (Dwarf4) (Dwarf protein 4) Length = 513 Score = 30.0 bits (66), Expect = 7.0 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -3 Query: 300 LQEKGRKGQDNLKPGKGSW*EGGETISM---ETRRVLRILLEQYMSRF 166 L+ + RK + NL PGK W GETI T L ++Q++S++ Sbjct: 28 LKRRNRKTRFNLPPGKSGWPFLGETIGYLKPYTATTLGDFMQQHVSKY 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,186,932 Number of Sequences: 219361 Number of extensions: 1705211 Number of successful extensions: 4668 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4668 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)