| Clone Name | rbasd26p09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IPOU_DROME (P24350) Inhibitory POU protein (I-POU) (Abnormal che... | 35 | 0.15 | 2 | PRLR_RAT (P05710) Prolactin receptor precursor (PRL-R) (Lactogen... | 31 | 3.6 | 3 | CHIA_LYCES (Q05539) Acidic 26 kDa endochitinase precursor (EC 3.... | 30 | 6.1 | 4 | FES_ECOLI (P13039) Enterochelin esterase (Ferric enterobactin es... | 30 | 8.0 |
|---|
>IPOU_DROME (P24350) Inhibitory POU protein (I-POU) (Abnormal chemosensory jump| 6 protein) Length = 396 Score = 35.4 bits (80), Expect = 0.15 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 116 SLHRWNHLCRHHHPGFLGKRLGSSHRRLLQ*RTRIHHP 229 S H NH+ HHHPG L G H + +HHP Sbjct: 176 SYHSMNHMMSHHHPGTLSGHTGGHHG-----HSAVHHP 208
>PRLR_RAT (P05710) Prolactin receptor precursor (PRL-R) (Lactogen receptor)| Length = 610 Score = 30.8 bits (68), Expect = 3.6 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = -3 Query: 424 PLFNATFGYKTGNNTRRRHLIQYRQTT*T*LMTGWWIDPHYSRDQPSSQTGWRLVNHSTG 245 P N T K + + +++ T T + TGW+ + R +P W + H TG Sbjct: 124 PPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEI--HFTG 181 Query: 244 HHQQARVMNSSPSLK 200 H Q +V + P K Sbjct: 182 HQTQFKVFDLYPGQK 196
>CHIA_LYCES (Q05539) Acidic 26 kDa endochitinase precursor (EC 3.2.1.14)| Length = 253 Score = 30.0 bits (66), Expect = 6.1 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +1 Query: 196 TPSMKDSNSSPGPADGVQLNG*LISIQFGCSVGPENSAD 312 TPS KD+ ++ P GV N +I+ QF C +GP +A+ Sbjct: 185 TPSPKDTAANRVPGYGVITN--IINGQFECGMGPNTAAE 221
>FES_ECOLI (P13039) Enterochelin esterase (Ferric enterobactin esterase)| Length = 374 Score = 29.6 bits (65), Expect = 8.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 331 MTGWWIDPHYSRDQPSSQTGWRLVNHSTGHHQQAR 227 +T WW DP S + + + W + T HHQ ++ Sbjct: 4 VTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQNSQ 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,905,006 Number of Sequences: 219361 Number of extensions: 1833655 Number of successful extensions: 4271 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4270 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)