| Clone Name | rbasd27c16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUTR1_DROME (Q9NDM2) Gustatory receptor trehalose 1 (Trehalose r... | 30 | 1.6 | 2 | ALO_ASHGO (Q752Y3) D-arabinono-1,4-lactone oxidase (EC 1.1.3.37)... | 28 | 6.0 |
|---|
>GUTR1_DROME (Q9NDM2) Gustatory receptor trehalose 1 (Trehalose receptor 1)| Length = 392 Score = 30.0 bits (66), Expect = 1.6 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -2 Query: 190 VLGVSFSCCYIWILKFSPSPRSAQKVQTVATVGSSRFTGRTGVTAYC 50 V+ VS+SC YI +L R+ Q A GSS G + +T C Sbjct: 213 VIIVSYSCIYITVLHQKKKIRNHDNFQIAAAKGSSSSGGGSYMTTTC 259
>ALO_ASHGO (Q752Y3) D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) (ALO)| (L-galactono-gamma-lactone oxidase) Length = 532 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = -2 Query: 133 PRSAQKVQTVATVGSSRFTGRTGVTAYCGGSPNYLCVS 20 PRS +V VA V ++R GRT VT G SP+ +C + Sbjct: 35 PRSEDEV--VAIVRAAREQGRTIVTVGSGHSPSDMCAT 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,538,396 Number of Sequences: 219361 Number of extensions: 644207 Number of successful extensions: 1513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)