| Clone Name | rbasd26n01 |
|---|---|
| Clone Library Name | barley_pub |
>6PGL_HUMAN (O95336) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 258 Score = 45.1 bits (105), Expect = 2e-04 Identities = 24/67 (35%), Positives = 32/67 (47%) Frame = -2 Query: 614 SXXPPXXRIXFXLXVIXXASNIXILXTGXXKANXVHLXVSDSSDGPXALTSLPARMVQPT 435 S PP R+ L V+ A + + TG KA + + D + P LPA +VQP Sbjct: 178 SPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENP-----LPAALVQPH 232 Query: 434 DGKLVWF 414 GKL WF Sbjct: 233 TGKLCWF 239
>6PGL_MOUSE (Q9CQ60) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 257 Score = 40.4 bits (93), Expect = 0.004 Identities = 23/67 (34%), Positives = 31/67 (46%) Frame = -2 Query: 614 SXXPPXXRIXFXLXVIXXASNIXILXTGXXKANXVHLXVSDSSDGPXALTSLPARMVQPT 435 S PP R+ L V+ A +I + TG KA + + D +LPA +VQP Sbjct: 178 SPKPPPQRVTLTLPVLNAAQSIIFVATGEGKAAVLKRILEDKEG------TLPAALVQPR 231 Query: 434 DGKLVWF 414 G L WF Sbjct: 232 TGALCWF 238
>PCQAP_HUMAN (Q96RN5) Positive cofactor 2 glutamine/Q-rich-associated protein| (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) Length = 788 Score = 30.4 bits (67), Expect = 4.3 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 112 SEATTPRINVVNAAQNHLRPPKPNVLPISWNEPSFGLTHEED*RRRSRANLLPA---YDS 282 S+A ++ ++ Q+H PP+P P++ N+PS + S+A LP Y Sbjct: 283 SQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQ 342 Query: 283 PP 288 PP Sbjct: 343 PP 344
>6PGL_STRCO (Q9XAB7) 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 261 Score = 30.0 bits (66), Expect = 5.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 614 SXXPPXXRIXFXLXVIXXASNIXILXTGXXKANXVHLXVSDSSD 483 S PP RI L I A + +L G KAN V + +S + + Sbjct: 182 SPKPPPIRISLTLPAIRAAREVWLLAAGEDKANAVAMALSGAGE 225
>DMBT1_MOUSE (Q60997) Deleted in malignant brain tumors 1 protein precursor| (CRP-ductin) (Vomeroglandin) Length = 2085 Score = 29.3 bits (64), Expect = 9.7 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = -1 Query: 279 VICWKKVSSRSTPLVLFVC*SKGWFVPGNRKNVWFWRTEMVLCGIDDVYAGR 124 VIC SS TP GW+ PG N F+ TE G D A R Sbjct: 283 VICSASQSSSPTP---------GWWNPGGTNNDVFYPTEQTTAGTDSGLAVR 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,510,961 Number of Sequences: 219361 Number of extensions: 1270860 Number of successful extensions: 2702 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2702 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)