| Clone Name | rbasd26m21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YDFI_ECOLI (P77260) Hypothetical oxidoreductase ydfI (EC 1.-.-.-) | 28 | 6.6 |
|---|
>YDFI_ECOLI (P77260) Hypothetical oxidoreductase ydfI (EC 1.-.-.-)| Length = 486 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 40 NITYPSQQVDMFVPQFGKSTPTKIKASEMTG-RFNRGILSSPLEE 171 N+T+PS VD VP + T KI+ ++TG R G+ P + Sbjct: 214 NVTFPSTMVDRIVPAVTEDTLAKIE--QLTGVRDPAGVACEPFRQ 256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,848,245 Number of Sequences: 219361 Number of extensions: 423931 Number of successful extensions: 1027 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)