| Clone Name | rbasd26m13 |
|---|---|
| Clone Library Name | barley_pub |
>RNF4_RAT (O88846) RING finger protein 4 (SNURF)| Length = 194 Score = 39.3 bits (90), Expect = 0.003 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVYL 157 GH+FC + ++ S++ CPTCR+K+ + +Y+ Sbjct: 159 GHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI 194
>RNF4_MOUSE (Q9QZS2) RING finger protein 4| Length = 194 Score = 39.3 bits (90), Expect = 0.003 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVYL 157 GH+FC + ++ S++ CPTCR+K+ + +Y+ Sbjct: 159 GHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI 194
>RNF4_HUMAN (P78317) RING finger protein 4| Length = 190 Score = 39.3 bits (90), Expect = 0.003 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVYL 157 GH+FC + ++ S++ CPTCR+K+ + +Y+ Sbjct: 155 GHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI 190
>RAD18_KLULA (Q6CTZ8) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 427 Score = 31.2 bits (69), Expect = 0.72 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVYL 157 GH FC I+ +Q KCP C LT S + +L Sbjct: 48 GHSFCSICIRKYLQKESKCPLCLSDLTESMLQKEFL 83
>PEX10_PICAN (Q00940) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (Peroxisome assembly protein PER8) Length = 295 Score = 30.8 bits (68), Expect = 0.94 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKL 187 GH+FC K + ++ ++CP CR K+ Sbjct: 261 GHVFCWKCVLDWVKERQECPLCRAKM 286
>BRE1_CANAL (Q5A4X0) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 681 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 273 TIXGHIFCXKXIKASIQX-XKKCPTCRRKLTISNFPRVYL 157 T+ GH+FC K + + ++CP+C R + ++ ++L Sbjct: 642 TVCGHVFCSKCTQERLAARLRRCPSCNRGFSANDLLSIHL 681
>AMFR2_HUMAN (Q9UKV5) Autocrine motility factor receptor, isoform 2 (EC 6.3.2.-)| (AMF receptor) (gp78) Length = 643 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRV 163 GH+F +++ ++ CPTCR L I++ RV Sbjct: 357 GHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRV 390
>BRE1A_HUMAN (Q5VTR2) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 975 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + +K +KCP C ++F R+Y+ Sbjct: 939 HVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYI 974
>BRE1A_CHICK (Q5ZLS3) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 984 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + +K +KCP C ++F R+Y+ Sbjct: 948 HVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYI 983
>BRE1A_MOUSE (Q5DTM8) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 973 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + +K +KCP C ++F R+Y+ Sbjct: 937 HVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYI 972
>YB1B_SCHPO (P87176) Hypothetical RING finger protein C3D6.11c in chromosome II| Length = 269 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = -1 Query: 264 GHIFCXKXIKASI---QXXKKCPTCRRKL 187 GHIFC I +++ +KCP CRRK+ Sbjct: 222 GHIFCNFCILSALGTTAATQKCPVCRRKV 250
>RFWD2_MOUSE (Q9R1A8) Ring finger and WD repeat domain protein 2 (EC 6.3.2.-)| (Ubiquitin-protein ligase COP1) (Constitutive photomorphogenesis protein 1 homolog) (mCOP1) Length = 733 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVY 160 GH FC K I S++ +CP C + N +Y Sbjct: 154 GHSFCYKCIHQSLEDNNRCPKC--NYVVDNIDHLY 186
>RFWD2_HUMAN (Q8NHY2) Ring finger and WD repeat domain protein 2 (EC 6.3.2.-)| (Ubiquitin-protein ligase COP1) (Constitutive photomorphogenesis protein 1 homolog) (hCOP1) Length = 731 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVY 160 GH FC K I S++ +CP C + N +Y Sbjct: 152 GHSFCYKCIHQSLEDNNRCPKC--NYVVDNIDHLY 184
>PEX10_MACFA (Q8HXW8) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 326 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRK 190 GH+FC + I A +CP CR K Sbjct: 289 GHLFCWECITAWCSSKAECPLCREK 313
>PEX10_HUMAN (O60683) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (RING finger protein 69) Length = 326 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRK 190 GH+FC + I A +CP CR K Sbjct: 289 GHLFCWECITAWCSSKAECPLCREK 313
>COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Constitutive| photomorphogenesis protein 1) Length = 672 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 273 TIXGHIFCXKXIKASIQXXKKCPTCRRKLTISN-FPRVYL 157 T GH FC I ++ CP C LT SN FP L Sbjct: 60 TACGHSFCYMCIITHLRNKSDCPCCGHYLTNSNLFPNFLL 99
>BRE1B_RAT (Q8CJB9) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) (Syntaxin-1-interacting RING finger protein) (Protein staring) Length = 1002 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + ++ + +KCP C +F RVY+ Sbjct: 966 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRVYI 1001
>BRE1B_MOUSE (Q3U319) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) Length = 1001 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + ++ + +KCP C +F RVY+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRVYI 1000
>BRE1_YEAST (Q07457) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-) (Brefeldin| A-sensitivity protein 1) Length = 700 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 264 GHIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 GH+FC K + +KCPTC + + ++ V+L Sbjct: 664 GHVFCENCCKERLAARMRKCPTCNKAFSSNDLLTVHL 700
>AMFR_MOUSE (Q9R049) Autocrine motility factor receptor (EC 6.3.2.19) (AMF| receptor) Length = 643 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPR 166 GH+F +++ ++ CPTCR L I++ R Sbjct: 357 GHLFHNSCLRSWLEQDTSCPTCRMSLNIADGSR 389
>RAD18_CANGA (Q6FPI4) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 411 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVYL 157 GH FC I+ + KCP C +L S YL Sbjct: 43 GHTFCSLCIRGYLSNEPKCPLCLHELRESMLRSEYL 78
>BRE1B_PONPY (Q5RAU7) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) Length = 1001 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + ++ + +KCP C +F R+Y+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYI 1000
>BRE1B_MACFA (Q4R7K7) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) Length = 1001 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + ++ + +KCP C +F R+Y+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYI 1000
>BRE1B_HUMAN (O75150) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) (95 kDa retinoblastoma-associated protein) (RBP95) Length = 1001 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC + ++ + +KCP C +F R+Y+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYI 1000
>BRE1_CANGA (Q6FWF3) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 693 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 264 GHIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 GH+FC K + +KCPTC + + ++ V+L Sbjct: 657 GHVFCEDCCKERLAARMRKCPTCNKPFSSNDLLMVHL 693
>RN125_MOUSE (Q9D9R0) RING finger protein 125 (EC 6.3.2.-)| Length = 232 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKK--CPTCRRKLTISNFP 169 GH+FC I SI+ K CP CR L P Sbjct: 52 GHVFCRSCIATSIKNNNKWTCPYCRAYLPSEGVP 85
>RNG2B_XENLA (Q7ZWM8) Ubiquitin ligase protein RING2-B (EC 6.3.2.-) (RING finger| protein 2-B) (RING finger protein 1B-B) (RING1b-B) Length = 343 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 65 HRFCSDCIVTALRSGNKECPTCRKKL 90
>RING1_RAT (Q6MGB6) Polycomb complex protein RING1 (RING finger protein 1)| Length = 406 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_MOUSE (O35730) Polycomb complex protein RING1 (RING finger protein 1)| (Transcription repressor Ring1A) Length = 406 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_HUMAN (Q06587) Polycomb complex protein RING1 (RING finger protein 1)| Length = 406 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_CANFA (Q5TJF3) Ubiquitin ligase protein RING1 (EC 6.3.2.-) (RING finger| protein 1) (RING1a) Length = 406 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_MACMU (Q8WMN5) Polycomb complex protein RING1 (RING finger protein 1)| Length = 377 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 37 HRFCSDCIVTALRSGNKECPTCRKKL 62
>RING1_DROME (Q9VB08) Ubiquitin ligase protein RING1 (EC 6.3.2.-) (dRING1)| (dRING protein) (Sex comb extra protein) Length = 435 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 64 HRFCSDCIVTALRSGNKECPTCRKKL 89
>ZP2_MOUSE (P20239) Zona pellucida sperm-binding protein 2 precursor (Zona| pellucida glycoprotein ZP2) (Zona pellucida protein A) Length = 713 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 261 HIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVYLPMA-XN*NLSSHSWSI 112 H FC I+A + CRR L +FP+++ +A N N+S W + Sbjct: 131 HFFC-PAIQAETHEISEIVVCRRDLISFSFPQLFSRLADENQNVSEMGWIV 180
>RNG2A_XENLA (Q66J69) Ubiquitin ligase protein RING2-A (EC 6.3.2.-) (RING finger| protein 2-A) (RING finger protein 1B-A) (RING1b-A) Length = 344 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RAD18_EMENI (Q02398) Postreplication repair ubiquitin-protein ligase E3 rad18| (EC 6.-.-.-) Length = 443 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 273 TIXGHIFCXKXIKASIQXXKKCPTCR 196 T H FC I+ + KCPTCR Sbjct: 43 TSCSHTFCSLCIRRCLSTEGKCPTCR 68
>RN141_CHICK (Q5ZM74) RING finger protein 141| Length = 230 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 261 HIFCXKXIKASIQXXKKCPTCRRKLT 184 H FC K I + CP CRR++T Sbjct: 171 HSFCQKCIDKWSDRHRSCPVCRRQVT 196
>RN125_MACFA (Q95KF1) RING finger protein 125 (EC 6.3.2.-)| Length = 231 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXK-KCPTCRRKLTISNFP 169 GH+FC I S++ K CP CR L P Sbjct: 52 GHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVP 84
>RN125_HUMAN (Q96EQ8) RING finger protein 125 (EC 6.3.2.-) (T-cell RING| activation protein 1) (TRAC-1) Length = 231 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXK-KCPTCRRKLTISNFP 169 GH+FC I S++ K CP CR L P Sbjct: 52 GHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVP 84
>BRE1_CAEEL (P34537) Ubiquitin-protein ligase bre-1 (EC 6.3.2.-) (RING finger| protein rfp-1) Length = 837 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC IK +KCP C ++F R+++ Sbjct: 802 HLFCETCIKTMYDTRQRKCPKCNSNFGANDFHRIFI 837
>RING2_RAT (Q4KLY4) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 308 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>CM007_PONPY (Q5RD97) Protein C13orf7 homolog| Length = 726 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 270 IXGHIFCXKXIKASIQXXKKCPTCRRKLTISN 175 I H+FC I ++ +CP CR +T N Sbjct: 32 INNHVFCSICIDLWLKNNSQCPACRVPITPEN 63
>CM007_HUMAN (Q5W0B1) Protein C13orf7| Length = 726 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 270 IXGHIFCXKXIKASIQXXKKCPTCRRKLTISN 175 I H+FC I ++ +CP CR +T N Sbjct: 32 INNHVFCSICIDLWLKNNSQCPACRVPITPEN 63
>BRE1_CAEBR (Q60YN5) Ubiquitin-protein ligase bre-1 (EC 6.3.2.-) (RING finger| protein rfp-1) Length = 828 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 H+FC IK +KCP C ++F R+++ Sbjct: 793 HLFCETCIKTMYDTRQRKCPKCNSNFGANDFHRIFI 828
>RING2_PONPY (Q5R9J5) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 336 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RING2_MOUSE (Q9CQJ4) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 336 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RING2_HUMAN (Q99496) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) (RING finger protein BAP-1) (DinG protein) (Huntingtin-interacting protein 2-interacting protein 3) (HIP2-interacting protein 3) Length = 336 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RING2_BRARE (Q803I4) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 336 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 261 HIFCXKXIKASIQXX-KKCPTCRRKL 187 H FC I +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>PEX12_DROME (Q9VPT5) Putative peroxisome assembly protein 12 (Peroxin-12)| Length = 297 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/38 (23%), Positives = 21/38 (55%) Frame = -1 Query: 273 TIXGHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVY 160 ++ G++FC K I + ++ CP +++ + R+Y Sbjct: 258 SVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIY 295
>BRE1_KLULA (Q6CWM4) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 663 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 264 GHIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 GH+FC K + +KCPTC + + ++ ++L Sbjct: 627 GHVFCDVCCKERLAARMRKCPTCNKPFSSNDLLSIHL 663
>BRE1_ASHGO (Q757D9) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 643 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 264 GHIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 GH+FC K + +KCPTC + + ++ V+L Sbjct: 607 GHVFCADCCKERLAARMRKCPTCNKGFSSNDLLVVHL 643
>PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10) (AthPEX10)| (Pex10p) (PER8) Length = 381 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 264 GHIFCXKXIKASIQXXKKCPTCRRKLTISNFPRVY 160 GH+FC I ++CP CR T S+ +Y Sbjct: 343 GHVFCWSCIMEWCNEKQECPLCRTPNTHSSLVCLY 377
>BRE1_DEBHA (Q6BWW6) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 691 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/40 (25%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -1 Query: 273 TIXGHIFCXKXIKASIQXX-KKCPTCRRKLTISNFPRVYL 157 T+ GH+FC + + ++CPTC + + ++ ++L Sbjct: 652 TVCGHVFCLGCTQERLAARLRRCPTCNKGFSANDLLSIHL 691 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,068,584 Number of Sequences: 219361 Number of extensions: 648368 Number of successful extensions: 1192 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)