| Clone Name | rbasd26m01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYI_METAC (Q8TN62) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 30 | 7.8 | 2 | M3K6_HUMAN (O95382) Mitogen-activated protein kinase kinase kina... | 30 | 7.8 |
|---|
>SYI_METAC (Q8TN62) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1058 Score = 29.6 bits (65), Expect = 7.8 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 80 SKHQMVYKTIRSMITGWLVHKR*RVIMSMCINKLSTFFLMEI 205 S+ Q V K + ++G+L+HK R I+ + LS +++ I Sbjct: 689 SRAQSVIKAVNEAMSGYLLHKAVREILEFALEDLSRWYIQLI 730
>M3K6_HUMAN (O95382) Mitogen-activated protein kinase kinase kinase 6 (EC| 2.7.11.25) Length = 1011 Score = 29.6 bits (65), Expect = 7.8 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +3 Query: 261 SQFLTFPDLMDP*FQ*LSQYPLSPPA*CLTYGGFRYLQ 374 +Q TFP P SQ+P SPP CL+YGG L+ Sbjct: 663 TQSQTFPCPQAP-----SQHPPSPPKRCLSYGGTSQLR 695 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,182,881 Number of Sequences: 219361 Number of extensions: 1713169 Number of successful extensions: 4161 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4161 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)