| Clone Name | rbasd27a13 |
|---|---|
| Clone Library Name | barley_pub |
>IAA24_ORYSA (Q6ZL57) Auxin-responsive protein IAA24 (Indoleacetic acid-induced| protein 24) Length = 219 Score = 35.4 bits (80), Expect = 0.13 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MFISSCK+LRIMK SEAR Sbjct: 202 MFISSCKKLRIMKGSEAR 219
>AX22D_PHAAU (O24542) Auxin-induced protein 22D (Indole-3-acetic acid-induced| protein ARG13) Length = 193 Score = 35.4 bits (80), Expect = 0.13 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -1 Query: 508 SMFISSCKRLRIMKSSEAR 452 +MF+SSCKRLRIMK SEA+ Sbjct: 170 NMFVSSCKRLRIMKGSEAK 188
>IAA31_ORYSA (P0C133) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 197 Score = 35.4 bits (80), Expect = 0.13 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MFIS+CKRLRIMK SEAR Sbjct: 173 MFISTCKRLRIMKGSEAR 190
>AX22B_PHAAU (P32294) Auxin-induced protein 22B (Indole-3-acetic acid-induced| protein ARG4) Length = 196 Score = 35.0 bits (79), Expect = 0.17 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF++SCKRLRIMK SEAR Sbjct: 173 MFVTSCKRLRIMKGSEAR 190
>IAA14_ORYSA (Q7Y1H8) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) Length = 195 Score = 34.3 bits (77), Expect = 0.29 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MFISSCK+LRIM+ SEAR Sbjct: 178 MFISSCKKLRIMRGSEAR 195
>AX22E_PHAAU (O24543) Auxin-induced protein 22E (Indole-3-acetic acid-induced| protein ARG14) Length = 203 Score = 33.9 bits (76), Expect = 0.38 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -1 Query: 508 SMFISSCKRLRIMKSSEAR 452 +MF+SSCKRLRI+K SEA+ Sbjct: 180 NMFVSSCKRLRIIKGSEAK 198
>IAA4_ARATH (P33077) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) (Auxin-induced protein AUX2-11) Length = 186 Score = 33.5 bits (75), Expect = 0.50 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF+SSCKRLRIMK SE + Sbjct: 162 MFVSSCKRLRIMKGSEVK 179
>IAA27_ARATH (Q9ZSY8) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) (Auxin-induced protein 27) (Phytochrome-associated protein 2) Length = 305 Score = 33.1 bits (74), Expect = 0.65 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MFI SCK+LRIMKSSEA Sbjct: 274 MFICSCKKLRIMKSSEA 290
>IAA30_ORYSA (P0C132) Auxin-responsive protein IAA30 (Indoleacetic acid-induced| protein 30) Length = 277 Score = 32.7 bits (73), Expect = 0.85 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK SEA Sbjct: 246 MFVESCKRLRIMKGSEA 262
>IAA14_ARATH (Q38832) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) (SOLITARY-ROOT protein) Length = 228 Score = 32.7 bits (73), Expect = 0.85 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK SEA Sbjct: 197 MFVESCKRLRIMKGSEA 213
>IAA13_ORYSA (Q7Y1Y5) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 236 Score = 32.7 bits (73), Expect = 0.85 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK SEA Sbjct: 205 MFVESCKRLRIMKGSEA 221
>IAA11_ORYSA (Q75GK0) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 233 Score = 32.7 bits (73), Expect = 0.85 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK SEA Sbjct: 204 MFVESCKRLRIMKGSEA 220
>IAA4_PEA (P49679) Auxin-induced protein IAA4| Length = 189 Score = 32.7 bits (73), Expect = 0.85 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF++SCKRLRIMK +EA+ Sbjct: 166 MFVTSCKRLRIMKGTEAK 183
>IAA7_ARATH (Q38825) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) (Auxin resistant 2) Length = 243 Score = 32.7 bits (73), Expect = 0.85 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK SEA Sbjct: 211 MFVESCKRLRIMKGSEA 227
>IAA23_ORYSA (Q69VE0) Auxin-responsive protein IAA23 (Indoleacetic acid-induced| protein 23) Length = 193 Score = 32.7 bits (73), Expect = 0.85 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKR+R+MKSSEA Sbjct: 167 MFVESCKRIRLMKSSEA 183
>IAA6_PEA (P49680) Auxin-induced protein IAA6| Length = 179 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MFI SCKRLRIMK S+A+ Sbjct: 148 MFIESCKRLRIMKRSDAK 165
>IAA3_ARATH (Q38822) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) (Short hypocotyl) (Suppressor of HY2) Length = 189 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MFI +CKRLRIMK SEA+ Sbjct: 166 MFICTCKRLRIMKGSEAK 183
>IAA26_ORYSA (Q652A1) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) Length = 140 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF+SSCKR+R+M++ EAR Sbjct: 117 MFVSSCKRMRVMRACEAR 134
>IAA16_ARATH (O24407) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 236 Score = 32.0 bits (71), Expect = 1.4 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKR+RIMK SEA Sbjct: 205 MFVDSCKRIRIMKGSEA 221
>AUX22_SOYBN (P13088) Auxin-induced protein AUX22| Length = 195 Score = 31.6 bits (70), Expect = 1.9 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF+ SCKRLRIMK S+A+ Sbjct: 159 MFMESCKRLRIMKKSDAK 176
>IAA2_ARATH (P49678) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 174 Score = 31.2 bits (69), Expect = 2.5 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF SSCKRLRIMK S+A Sbjct: 151 MFSSSCKRLRIMKGSDA 167
>AUX28_SOYBN (P13089) Auxin-induced protein AUX28| Length = 243 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK EA Sbjct: 210 MFVESCKRLRIMKGKEA 226
>IAA1_ORYSA (Q5VRD1) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 199 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ +C+RLR+MKSSEA Sbjct: 174 MFVETCQRLRLMKSSEA 190
>IAA15_ORYSA (Q6AT10) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 212 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ +C+RLR+MKSSEA Sbjct: 188 MFVETCQRLRLMKSSEA 204
>IAA19_ARATH (O24409) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) (MASSUGU2 protein) Length = 197 Score = 30.8 bits (68), Expect = 3.2 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ SCKRLRIMK S+A Sbjct: 169 MFLESCKRLRIMKRSDA 185
>VSR6_ARATH (Q9FYH7) Vacuolar sorting receptor 6 precursor (AtVSR6) (Epidermal| growth factor receptor-like protein 6) (AtELP6) (BP80-like protein d) (AtBP80d) Length = 622 Score = 30.0 bits (66), Expect = 5.5 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 4/75 (5%) Frame = +2 Query: 137 RYCMLPAXXXXXXXXXXXXACESLDPASRSYRAGGCRS---VHFTERACVNRLAHGSRPP 307 R C P +CE PA S GGC S T AC N G R P Sbjct: 442 RVCECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSETKKGLTFSACSNLETSGCRCP 501 Query: 308 SPFT-HGRPDHACVC 349 F G AC C Sbjct: 502 PGFKGDGLKCEACQC 516
>IAA12_ORYSA (Q75GK1) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) Length = 226 Score = 30.0 bits (66), Expect = 5.5 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF S+CK+LRIMK SEA Sbjct: 199 MFTSTCKKLRIMKRSEA 215
>AX22A_PHAAU (P32293) Auxin-induced protein 22A (Indole-3-acetic acid-induced| protein ARG3) Length = 194 Score = 30.0 bits (66), Expect = 5.5 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF+ SCKRLRIMK ++A+ Sbjct: 158 MFMESCKRLRIMKRADAK 175
>BCHJ_RHOS4 (Q9Z5D7) Bacteriochlorophyll synthase 23 kDa chain (4-vinyl| reductase) Length = 206 Score = 29.6 bits (65), Expect = 7.2 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +1 Query: 115 NSTASLLPLLHATCAPIRPDWPPELARL*VPGPSLAFVPSGWMQISTLHR 264 N+ L+P+L A P D A + PGP +P Q+STLHR Sbjct: 21 NAILQLIPVLEAAFGPGAADRALAAAGVPRPGPESGMLPE--TQVSTLHR 68
>IAA1_ARATH (P49677) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 168 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF SSC++LRIMK SEA Sbjct: 148 MFSSSCQKLRIMKGSEA 164
>IAA17_ARATH (P93830) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) (Auxin response 3) Length = 229 Score = 29.6 bits (65), Expect = 7.2 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF+ +CKRLR+MK S+A Sbjct: 198 MFVDTCKRLRLMKGSDA 214
>AX22C_PHAAU (O24541) Auxin-induced protein 22C (Indole-3-acetic acid-induced| protein ARG12) Length = 188 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEAR 452 MF SCKRLRIMK S+A+ Sbjct: 152 MFRESCKRLRIMKRSDAK 169
>IAA13_ARATH (Q38831) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 247 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MFI+S KRLR+MK+SEA Sbjct: 212 MFINSVKRLRVMKTSEA 228
>ZN575_MOUSE (Q3TXZ1) Zinc finger protein 575| Length = 239 Score = 29.6 bits (65), Expect = 7.2 Identities = 31/121 (25%), Positives = 46/121 (38%), Gaps = 21/121 (17%) Frame = +2 Query: 212 PASRSYRAGGC-RSVHFTERACVNRLAHGSRPPSP------------------FTH-GRP 331 P R +R C ++ + + +RLAHG P P TH G Sbjct: 52 PPQRPHRCPDCPKAFSYPSKLATHRLAHGGTRPHPCPDCPKAFSYPSKLAAHRLTHSGAR 111 Query: 332 DHACVCVSVSDHEPRTASFHRLRIASFMYVCTIVSFSSPSSCFRAFHYPQPLAG-RDEHA 508 H+C H P+ A HR ++A+ ++ C ++F YP LA R H Sbjct: 112 PHSC------PHCPK-AFGHRSKLAAHLWTHAPARPYPCPDCPKSFCYPSKLAAHRHTHH 164 Query: 509 A 511 A Sbjct: 165 A 165
>IAA17_ORYSA (Q75GB1) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) Length = 257 Score = 29.3 bits (64), Expect = 9.4 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 505 MFISSCKRLRIMKSSEA 455 MF +SC+RLRIMK S+A Sbjct: 226 MFANSCRRLRIMKGSDA 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,097,375 Number of Sequences: 219361 Number of extensions: 1770522 Number of successful extensions: 4068 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 3926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4066 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)