| Clone Name | rbasd27a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FTSZ_MYCPU (Q50318) Cell division protein ftsZ | 31 | 2.8 | 2 | LEUD_BACAN (Q81T65) 3-isopropylmalate dehydratase small subunit ... | 30 | 6.1 | 3 | DNAK_THEFY (Q47TI0) Chaperone protein dnaK (Heat shock protein 7... | 29 | 8.0 |
|---|
>FTSZ_MYCPU (Q50318) Cell division protein ftsZ| Length = 390 Score = 30.8 bits (68), Expect = 2.8 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 296 MATIARRLRACWIQIMSVPIRFSGWLSRLQKSKGLRLTRAIS 171 +A IAR L A I I++ P F G L +G++ RA+S Sbjct: 115 IAKIARELGALTISIVTTPFEFEGNLRNKNAQEGIKNLRAVS 156
>LEUD_BACAN (Q81T65) 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 193 Score = 29.6 bits (65), Expect = 6.1 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 438 WRLFRERHELAQHPALPVEYGGAPGLPTGRPCGLAGSSRAHA 563 WR ERHE P + GA L TG G GSSR HA Sbjct: 46 WRYDNERHENPNFPLNAPDRKGASILITGNNFG-CGSSREHA 86
>DNAK_THEFY (Q47TI0) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 613 Score = 29.3 bits (64), Expect = 8.0 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = -1 Query: 294 GDNCTEIACLLDPDHVGADQ-----VQWLVEQIAEEQGLEVDKGYFTDLSKDMM 148 GD E+ +H+G D V WLVE+ G+ DLSKD M Sbjct: 183 GDGVVEVKATHGDNHLGGDDWDQAVVDWLVERFKSSNGI--------DLSKDKM 228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,698,654 Number of Sequences: 219361 Number of extensions: 1948148 Number of successful extensions: 6669 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6658 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)