| Clone Name | rbasd26i05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VWF_HUMAN (P04275) Von Willebrand factor precursor (vWF) [Contai... | 29 | 7.7 | 2 | VP10_RDVO (P16594) Nonstructural protein Pns10 | 29 | 10.0 | 3 | VP10_RDVA (Q85447) Nonstructural protein Pns10 | 29 | 10.0 |
|---|
>VWF_HUMAN (P04275) Von Willebrand factor precursor (vWF) [Contains: Von| Willebrand antigen II] Length = 2813 Score = 29.3 bits (64), Expect = 7.7 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = -2 Query: 429 HNKQVPEISPCYEN---GNGIGIAWFTRGICRGQLQE--VEDICVHFCTRHC 289 H +QV E+ Y + NG+ + W T C V + C H C RHC Sbjct: 2169 HQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC 2220
>VP10_RDVO (P16594) Nonstructural protein Pns10| Length = 353 Score = 28.9 bits (63), Expect = 10.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 503 YKVFFYCNATAFMASMAMVSLLLNNTISKYQRSLL 399 Y F+YCN++A+ ++ VS +N S QR+LL Sbjct: 157 YDTFYYCNSSAYGKNLISVS---DNDFSNPQRALL 188
>VP10_RDVA (Q85447) Nonstructural protein Pns10| Length = 353 Score = 28.9 bits (63), Expect = 10.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 503 YKVFFYCNATAFMASMAMVSLLLNNTISKYQRSLL 399 Y F+YCN++A+ ++ VS +N S QR+LL Sbjct: 157 YDTFYYCNSSAYGKNLISVS---DNDFSNPQRALL 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,178,601 Number of Sequences: 219361 Number of extensions: 1613089 Number of successful extensions: 4055 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4054 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)