| Clone Name | rbasd26h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AERA_AERSA (Q08676) Aerolysin precursor (Hemolysin-3) | 31 | 3.2 | 2 | AERA_AERSO (Q06304) Aerolysin precursor (Hemolysin) | 31 | 3.2 | 3 | WDR24_XENLA (Q7ZX22) WD-repeat protein 24 | 30 | 4.2 | 4 | ALG6_SCHPO (O43053) Probable dolichyl pyrophosphate Man9GlcNAc2 ... | 30 | 4.2 | 5 | ARNT_WIGBR (Q8D339) Undecaprenyl phosphate-alpha-4-amino-4-deoxy... | 29 | 9.3 |
|---|
>AERA_AERSA (Q08676) Aerolysin precursor (Hemolysin-3)| Length = 489 Score = 30.8 bits (68), Expect = 3.2 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +2 Query: 161 YMVFPGFYIEHKTGIHQVRNNHSIFPRCNSDYDVADQFTLFVDSHRVL-NNNGYILGLRC 337 Y + P Y+ H G V NHS P D DV T D + NN+G G RC Sbjct: 136 YFIKPVSYLAHYLGYAWVGGNHS--PYVGEDMDV----TRVGDGWLIKGNNDGGCSGYRC 189 Query: 338 GNRS 349 G +S Sbjct: 190 GEKS 193
>AERA_AERSO (Q06304) Aerolysin precursor (Hemolysin)| Length = 488 Score = 30.8 bits (68), Expect = 3.2 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +2 Query: 161 YMVFPGFYIEHKTGIHQVRNNHSIFPRCNSDYDVADQFTLFVDSHRVL-NNNGYILGLRC 337 Y + P Y+ H G V NHS P D DV T D + NN+G G RC Sbjct: 135 YFIKPVSYLAHYLGYAWVGGNHS--PYVGEDMDV----TRVGDGWLIKGNNDGGCSGYRC 188 Query: 338 GNRS 349 G +S Sbjct: 189 GEKS 192
>WDR24_XENLA (Q7ZX22) WD-repeat protein 24| Length = 780 Score = 30.4 bits (67), Expect = 4.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 571 VRCSCCSTVNLVRPVNNIAHVNCGRCRTTLMYPHGAPSVKCAICD 437 ++ S CS++N + + HVNC C+ + S K ICD Sbjct: 687 IKLSTCSSINCLNQASTTLHVNCSNCKRPM-------SNKGWICD 724
>ALG6_SCHPO (O43053) Probable dolichyl pyrophosphate Man9GlcNAc2| alpha-1,3-glucosyltransferase (EC 2.4.1.-) (Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase) Length = 506 Score = 30.4 bits (67), Expect = 4.2 Identities = 17/66 (25%), Positives = 34/66 (51%) Frame = +2 Query: 41 IFRIQLSTCMLSLVKFQKTLYVSLFFQVRQQPITKGWKYQYMVFPGFYIEHKTGIHQVRN 220 IF L TC+ ++F + + +S +T + + ++FP Y+++KT + Q+ Sbjct: 230 IFFYLLGTCVKPKIRFSRFILLS---------VTVVFTFSLILFPWIYMDYKTLLPQIL- 279 Query: 221 NHSIFP 238 H +FP Sbjct: 280 -HRVFP 284
>ARNT_WIGBR (Q8D339) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 562 Score = 29.3 bits (64), Expect = 9.3 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 171 KTMYWYFQPLVIGCCLTWKN--KDT*SVFWNFTKESMHVESCILKMLIL 31 K+ +WY+ P+ I CL W T ++ WN T+++ +E +L +I+ Sbjct: 265 KSPFWYYFPIFIIGCLPWSGFLFSTLNLAWN-TRKNKKIEFYLLLWIIV 312 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,259,202 Number of Sequences: 219361 Number of extensions: 2051076 Number of successful extensions: 5173 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5173 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)