| Clone Name | rbasd26g03 |
|---|---|
| Clone Library Name | barley_pub |
>MC5R_PANTR (Q9TT23) Melanocortin receptor 5 (MC5-R)| Length = 325 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = -3 Query: 156 FLLVYACLKYVYILLVQWAGSILHGMWYQCSWFXIVF 46 ++ ++ L+Y +I+ + +G+I+ G+W C+ IVF Sbjct: 141 YVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVF 177
>MC5R_HUMAN (P33032) Melanocortin receptor 5 (MC5-R) (MC-2)| Length = 325 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = -3 Query: 156 FLLVYACLKYVYILLVQWAGSILHGMWYQCSWFXIVF 46 ++ ++ L+Y +I+ + +G+I+ G+W C+ IVF Sbjct: 141 YVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVF 177
>PHO85_KLULA (Q92241) Negative regulator of the PHO system (EC 2.7.11.22)| (Serine/threonine-protein kinase PHO85) Length = 304 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 75 TTCHARWNQPTALIIYTHILGKHKPRESRNSCQRNSEHSDDD 200 T W Q T L Y +L H PR+ + Q N+E DD Sbjct: 227 TPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDD 268
>YCEL_CAEEL (Q94175) Hypothetical protein C43G2.4 in chromosome IV| Length = 399 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 117 LLVQWAGSILHGMWYQCSWFXIVFGFTAFTEVH 19 LL++W GSI +W + F +F F F+ H Sbjct: 12 LLLRWKGSIWRSVWRELFLFLFLFYFIRFSAPH 44
>PACC_MAGGR (Q52B93) pH-response transcription factor pacC/RIM101| Length = 559 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 9/47 (19%) Frame = +3 Query: 69 TDTTCHARWNQ-----PTALIIYTHILGKHKPRESRN----SCQRNS 182 +D + RWNQ P+A +Y HI +H R+S N +C NS Sbjct: 48 SDDSLICRWNQCSERFPSAEALYDHICERHVGRKSTNNLNLTCHWNS 94
>ZBT39_HUMAN (O15060) Zinc finger and BTB domain-containing protein 39| Length = 712 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 Query: 162 NSCQRNSEHSDDDVIHFGQVESLRL 236 NSC NSEHS D FGQ++ L+L Sbjct: 274 NSCLSNSEHSKDP--GFGQMDELQL 296 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,857,624 Number of Sequences: 219361 Number of extensions: 752295 Number of successful extensions: 1614 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1614 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)