| Clone Name | rbasd25p13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YB8B_YEAST (P38355) Protein YBR287W | 27 | 8.9 | 2 | YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromo... | 27 | 8.9 |
|---|
>YB8B_YEAST (P38355) Protein YBR287W| Length = 427 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 214 LILISYSTVME*STGILPESIHKLYSLFISDLFSP 110 +++I+ + S+G+LP+ K+ SL DLF+P Sbjct: 21 VVIIALAGFWSASSGLLPKQSQKIISLLNVDLFTP 55
>YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromosome III| Length = 610 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 268 WISRILGYYSIFLYDDTILILISY 197 +ISR L Y +F D ++I+ISY Sbjct: 438 YISRFLSYLPLFTIDGALMIVISY 461 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,848,304 Number of Sequences: 219361 Number of extensions: 1063435 Number of successful extensions: 1802 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1802 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)