| Clone Name | rbasd26e16 |
|---|---|
| Clone Library Name | barley_pub |
>MFGM_PIG (P79385) Lactadherin (Milk fat globule-EGF factor 8) (MFG-E8)| (MFGM) (Sperm surface protein SP47) (PP47) Length = 409 Score = 31.2 bits (69), Expect = 2.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 530 KVTGEAXKHSQGEGHPVKLVPYNPNYQXESVLWTEXRDVGA 408 +VTG + ++ GH + Y Y + V WTE RD GA Sbjct: 320 RVTGIITQGARDFGHIQYVAAYKVAYSDDGVSWTEYRDQGA 360
>MFGM_BOVIN (Q95114) Lactadherin precursor (Milk fat globule-EGF factor 8)| (MFG-E8) (MGP57/53) (PAS-6/PAS-7 glycoprotein) (MFGM) (Sperm surface protein SP47) (BP47) (Components 15/16) Length = 427 Score = 29.6 bits (65), Expect = 6.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 530 KVTGEAXKHSQGEGHPVKLVPYNPNYQXESVLWTEXRDVGA 408 +VTG + ++ GH + Y Y + V WTE +D GA Sbjct: 338 RVTGIITQGARDFGHIQYVAAYRVAYGDDGVTWTEYKDPGA 378
>CBLB_HUMAN (Q13191) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) Length = 982 Score = 29.3 bits (64), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 289 SHHFHSTREVPSRTPPCSLSPW 354 S H H VPSR PP L W Sbjct: 572 SRHIHHVESVPSRDPPMPLEAW 593
>FUR11_DROME (P26016) Furin-like protease 1, isoforms 1/1-X/2 precursor (EC| 3.4.21.75) (Furin-1) (Kex2-like endoprotease 1) (dKLIP-1) Length = 1269 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 128 DASPPPTAHDF--YSTDTATDHRLISTNSVXRWRSMQLQQHDTFTRGGSSSAGCL 286 D + P ++ F Y D A H + +S +WR+MQ TR S++A CL Sbjct: 1173 DVANPSQSNQFNLYGNDMA--HNDVEYDSTGQWRNMQQVGEVGMTRDHSNTAACL 1225
>FUR1C_DROME (P30430) Furin-like protease 1, isoform 1-CRR precursor (EC| 3.4.21.75) (Furin-1) (Kex2-like endoprotease 1) (dKLIP-1) Length = 1101 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 128 DASPPPTAHDF--YSTDTATDHRLISTNSVXRWRSMQLQQHDTFTRGGSSSAGCL 286 D + P ++ F Y D A H + +S +WR+MQ TR S++A CL Sbjct: 796 DVANPSQSNQFNLYGNDMA--HNDVEYDSTGQWRNMQQVGEVGMTRDHSNTAACL 848 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,761,054 Number of Sequences: 219361 Number of extensions: 1173813 Number of successful extensions: 2868 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2866 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)