| Clone Name | rbasd25o22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CDH_PHACH (Q01738) Cellobiose dehydrogenase precursor (EC 1.1.99... | 29 | 7.8 |
|---|
>CDH_PHACH (Q01738) Cellobiose dehydrogenase precursor (EC 1.1.99.18) (CDH)| (Cellobiose-quinone oxidoreductase) Length = 773 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +1 Query: 241 YQPQVTL*GNYWYHRPXXSSKTPEGVFSXEVYAXTTNNLXTCDQDLXPRLP 393 Y P T+ N+W S V V TNNL D + P LP Sbjct: 698 YDP-ATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLP 747 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,745,031 Number of Sequences: 219361 Number of extensions: 860104 Number of successful extensions: 1299 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1299 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)