| Clone Name | rbasd25o08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IE68_SHV21 (Q01042) Immediate-early protein | 28 | 5.3 | 2 | PMYT1_MOUSE (Q9ESG9) Membrane-associated tyrosine- and threonine... | 28 | 7.0 |
|---|
>IE68_SHV21 (Q01042) Immediate-early protein| Length = 407 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 301 KVPKMKASSSRYCSSFKVSKLKASQRSXCWVVFSFG 194 KVPK + +++ S S L S +S CWVV +G Sbjct: 289 KVPKKYQARNKFFSQAAPSVLDLSPKSWCWVVDFWG 324
>PMYT1_MOUSE (Q9ESG9) Membrane-associated tyrosine- and threonine-specific| cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase) Length = 490 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -2 Query: 306 VSRSQR*RPPAAGTVPVSRFQS*RLPRDPXAGW 208 +SRS RPPA G +PVSR R P GW Sbjct: 38 LSRSLPPRPPAKGCIPVSRLFPPRTP-----GW 65 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,463,074 Number of Sequences: 219361 Number of extensions: 872251 Number of successful extensions: 1645 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1645 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)