| Clone Name | rbasd26d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ELAS_PSEAE (P14756) Pseudolysin precursor (EC 3.4.24.26) (Elasta... | 30 | 2.2 | 2 | MRT4_YEAST (P33201) mRNA turnover protein 4 | 30 | 3.7 | 3 | PTH_RHIME (Q92N67) Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH) | 28 | 8.2 |
|---|
>ELAS_PSEAE (P14756) Pseudolysin precursor (EC 3.4.24.26) (Elastase) (Neutral| metalloproteinase) Length = 498 Score = 30.4 bits (67), Expect = 2.2 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = -3 Query: 407 PSSGQVKLGGGYSGSLD-LASSRVPRCSNQTTLLFTDVGLRVVAE---KVKTKARGDFDR 240 P + Q +G G + L + S+ +P T G+RVV E +VK + + Sbjct: 43 PVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAAQ 102 Query: 239 RSSSWVSFVAALHPGSPVAAVS 174 RS +V+ +AA PGS AAVS Sbjct: 103 RSGHFVANIAADLPGSTTAAVS 124
>MRT4_YEAST (P33201) mRNA turnover protein 4| Length = 236 Score = 29.6 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 332 CSNQTTLLFTDVGLRVVAEKVKTKARGDFDR 240 CS T LLFTD + V E K+ R D+ R Sbjct: 96 CSGVTGLLFTDEDVNTVKEYFKSYVRSDYSR 126
>PTH_RHIME (Q92N67) Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)| Length = 239 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = -3 Query: 395 QVKLGGGYSGSLDLASSRVPRCSNQTTLLFTDVGLRVVAEKVKTKARGDFDRRSSSWVSF 216 ++K GGG+ G + S C + L +G V + V GDF + +W+S Sbjct: 101 RIKTGGGHGGHNGIKSIDA-HCGKEYRRLRLGIGHPGVKDLVHAHVLGDFAKADQAWLSL 159 Query: 215 V 213 + Sbjct: 160 L 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,603,534 Number of Sequences: 219361 Number of extensions: 1187489 Number of successful extensions: 3185 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3185 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)