| Clone Name | rbasd25l17 |
|---|---|
| Clone Library Name | barley_pub |
>POLG_POL2W (P23069) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2204 Score = 32.3 bits (72), Expect = 0.52 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 5/84 (5%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1905 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVVTGSAVGCDPDLFWS 1964 Query: 200 KVAALGLIFNGLVAQVTYEQDISP 129 K+ L+ L Y+ +SP Sbjct: 1965 KIPV--LMEEKLFDYTGYDASLSP 1986
>POLG_POL2L (P06210) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2206 Score = 31.6 bits (70), Expect = 0.89 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1905 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVVTGSAVGCDPDLFWS 1964 Query: 200 KVAAL 186 K+ L Sbjct: 1965 KIPVL 1969
>POLG_POL3L (P03302) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2205 Score = 31.6 bits (70), Expect = 0.89 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1904 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHRNPGVVTGSAVGCDPDLFWS 1963 Query: 200 KVAAL 186 K+ L Sbjct: 1964 KIPVL 1968
>POLG_POL32 (P06209) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2205 Score = 31.6 bits (70), Expect = 0.89 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1904 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVVTGSAVGCDPDLFWS 1963 Query: 200 KVAAL 186 K+ L Sbjct: 1964 KIPVL 1968
>POLG_CXA21 (P22055) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2205 Score = 31.6 bits (70), Expect = 0.89 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1904 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVVTGSAVGCDPDLFWS 1963 Query: 200 KVAAL 186 K+ L Sbjct: 1964 KIPVL 1968
>POLG_CXA24 (P36290) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2213 Score = 31.6 bits (70), Expect = 0.89 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1912 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVVTGSAVGCDPDLFWS 1971 Query: 200 KVAAL 186 K+ L Sbjct: 1972 KIPVL 1976
>POLG_POL1S (P03301) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2208 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1907 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWS 1966 Query: 200 KVAAL 186 K+ L Sbjct: 1967 KIPVL 1971
>POLG_POL1M (P03300) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2208 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -1 Query: 365 EEIKVKAKIEAQKVREIAEESAGSKTRM-----NIYLALMAILGLTIANAVFATPEVEWR 201 +E++ K K+E K R I S M N+Y A G+ +AV P++ W Sbjct: 1907 DELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWS 1966 Query: 200 KVAAL 186 K+ L Sbjct: 1967 KIPVL 1971
>RPOC_XYLFA (Q9PA87) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1407 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/53 (24%), Positives = 32/53 (60%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKTRMNI 276 +E +K EGM F + ++K +N +++ AK++ ++ EI + G +++ ++ Sbjct: 517 LENKKGEGMVFANTSELKRAYDNSVVELHAKVKV-RITEIETDDRGLRSKASL 568
>RPOC_XANC5 (Q3BWZ0) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1404 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/49 (26%), Positives = 30/49 (61%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKT 288 +E +K EGM F + +VK +N +++ AK++ ++ ++ E+ G ++ Sbjct: 517 LENKKGEGMVFANTSEVKRAYDNRVVELHAKVKV-RITQVDVEAGGKRS 564
>RPOC_XANAC (Q8PNS9) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1404 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/49 (26%), Positives = 30/49 (61%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKT 288 +E +K EGM F + +VK +N +++ AK++ ++ ++ E+ G ++ Sbjct: 517 LENKKGEGMVFANTSEVKRAYDNRVVELHAKVKV-RITQVDVEAGGKRS 564
>IOVO_TADRA (P68157) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_SARME (P68156) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_NEOJU (P68155) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_MERCU (P68154) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_LOPSP (P68153) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_DRONO (P05560) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++YN KC CN Sbjct: 17 EYMPLCGSDSKTYNNKCDFCN 37
>IOVO_CYACY (P68152) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_COSCO (P05571) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_CHLPI (P68151) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_ANAPL (P68150) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_ANACA (P68149) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_ALOAE (P68148) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_AIXSP (P68145) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>IOVO_AIXGA (P68144) Ovomucoid (Fragment)| Length = 54 Score = 30.4 bits (67), Expect = 2.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY+P D ++Y KC CN Sbjct: 5 DCSGYPKPACTMEYMPLCGSDNKTYGNKCNFCN 37
>RPOC_XYLFT (Q87A33) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1407 Score = 30.4 bits (67), Expect = 2.0 Identities = 16/71 (22%), Positives = 38/71 (53%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKTRMNIYLALMAI 255 +E +K EGM F + ++K +N +++ AK++ ++ EI + G + + + +I Sbjct: 517 LENKKGEGMVFANTSELKRAYDNSVVELHAKVKV-RITEIETDDQGLRNKAS------SI 569 Query: 254 LGLTIANAVFA 222 + T+ A+ + Sbjct: 570 VDTTVGRALLS 580
>IOVO_GALCH (P68379) Ovomucoid (Fragment)| Length = 54 Score = 30.0 bits (66), Expect = 2.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G S EY+P D ++Y+ KC CN Sbjct: 5 DCSGYPQPACSLEYVPFCGSDNKTYSNKCDFCN 37
>IOVO_FULAT (P68378) Ovomucoid (Fragment)| Length = 54 Score = 30.0 bits (66), Expect = 2.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G S EY+P D ++Y+ KC CN Sbjct: 5 DCSGYPQPACSLEYVPFCGSDNKTYSNKCDFCN 37
>YOAV_BACSU (O34416) Hypothetical transport protein yoaV| Length = 292 Score = 30.0 bits (66), Expect = 2.6 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 284 MNIYLALMAILGLTIANAVF-ATPEVEWRKVAALGLIFNGLVA 159 MN + +M + L + + +F A P EW A L+FNGL++ Sbjct: 180 MNAWHLMMGAVMLLVFSFIFEAVPSAEWTYQAVWSLLFNGLLS 222
>ATPF_CLOAB (O05098) ATP synthase B chain (EC 3.6.3.14)| Length = 159 Score = 30.0 bits (66), Expect = 2.6 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAE 309 +E+ K +G KVK + +EEI +AK EAQ + E A+ Sbjct: 66 LEDSKLQGKTIVENYKVKAEKVSEEITAEAKTEAQNILERAK 107
>IOVO_TINMA (P52254) Ovomucoid (Fragment)| Length = 51 Score = 29.6 bits (65), Expect = 3.4 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G + EY P D ++Y+ KC CN Sbjct: 4 DCSGYPKPACTAEYFPLCGSDNQTYSNKCAFCN 36
>IOVO_CASCA (P62337) Ovomucoid (Fragment)| Length = 54 Score = 29.6 bits (65), Expect = 3.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 288 SDEYLPCTHGDTRSYNRKCRLCN 220 S EY+P D+++YN KC C+ Sbjct: 15 SPEYMPLCGSDSKTYNNKCDFCS 37
>IOVO_CASBE (P62336) Ovomucoid (Fragment)| Length = 54 Score = 29.6 bits (65), Expect = 3.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 288 SDEYLPCTHGDTRSYNRKCRLCN 220 S EY+P D+++YN KC C+ Sbjct: 15 SPEYMPLCGSDSKTYNNKCDFCS 37
>RPOC_XANOR (Q8KTH8) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1405 Score = 29.6 bits (65), Expect = 3.4 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKT 288 +E +K EGM F + +VK +N +++ AK++ + + + G +T Sbjct: 517 LENKKGEGMVFANTSEVKRAYDNRVVELHAKVKVRITQVDVDAVDGKRT 565
>RPOC_XANCP (Q8PC55) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1405 Score = 29.6 bits (65), Expect = 3.4 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKT 288 +E +K EGM F + +VK +N +++ AK++ + + + G +T Sbjct: 517 LENKKGEGMVFANTSEVKRAYDNRVVELHAKVKVRITQVDVDTVDGKRT 565
>RPOC_XANC8 (Q4URD3) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1405 Score = 29.6 bits (65), Expect = 3.4 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = -1 Query: 434 IEEEKXEGMFFKSLGKVKXPQNNEEIKVKAKIEAQKVREIAEESAGSKT 288 +E +K EGM F + +VK +N +++ AK++ + + + G +T Sbjct: 517 LENKKGEGMVFANTSEVKRAYDNRVVELHAKVKVRITQVDVDTVDGKRT 565
>IOVO_SPHHU (P05563) Ovomucoid (Fragment)| Length = 54 Score = 29.3 bits (64), Expect = 4.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCNFCN 37
>IOVO_PYGAD (P67941) Ovomucoid (Fragment)| Length = 54 Score = 29.3 bits (64), Expect = 4.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCNFCN 37
>IOVO_PHASU (P05564) Ovomucoid (Fragment)| Length = 54 Score = 29.3 bits (64), Expect = 4.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCNFCN 37
>IOVO_PHAAL (P67940) Ovomucoid (Fragment)| Length = 54 Score = 29.3 bits (64), Expect = 4.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCNFCN 37
>IOVO_GALAS (P52266) Ovomucoid (Fragment)| Length = 54 Score = 29.3 bits (64), Expect = 4.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC G +Y+P D ++Y+ KC CN Sbjct: 5 DCSGYPQSACPQDYVPFCGSDNKTYSNKCNFCN 37
>IOVO_ANHNO (P05565) Ovomucoid (Fragment)| Length = 54 Score = 29.3 bits (64), Expect = 4.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCNFCN 37
>YSR4_CAEEL (Q09952) Hypothetical protein F59B10.4| Length = 267 Score = 29.3 bits (64), Expect = 4.4 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -1 Query: 284 MNIYLALMAILGLTIANAVFATPEVEWRKVAALGLIFNGLVAQVTYE 144 +N L L+A+LG+ + P + W+ V L L+F G ++ Y+ Sbjct: 76 VNFSLVLLALLGINSKVSSMILPALVWKCVLLLFLLFLGCISVDAYQ 122
>IOVO_RHEAM (P67942) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC S EY+P D+++Y+ KC CN Sbjct: 5 DCSDHPKPVCSLEYMPLCGSDSKTYSNKCDFCN 37
>IOVO_PTEPE (P67943) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 318 DCRGECGVKNSDEYLPCTHGDTRSYNRKCRLCN 220 DC S EY+P D+++Y+ KC CN Sbjct: 5 DCSDHPKPVCSLEYMPLCGSDSKTYSNKCDFCN 37
>IOVO_GRUVI (P68382) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPFCGSDSKTYSNKCNFCN 37
>IOVO_GRUJA (P68380) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPFCGSDSKTYSNKCNFCN 37
>IOVO_GRUCA (P68383) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPFCGSDSKTYSNKCNFCN 37
>IOVO_BALPA (P52239) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPFCGSDSKTYSNKCNFCN 37
>IOVO_ANTVI (P68381) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPFCGSDSKTYSNKCNFCN 37
>IOVO_ANSIN (P68437) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y+ KC CN Sbjct: 17 EYMPLCGSDNKTYDNKCNFCN 37
>IOVO_ANSAN (P68389) Ovomucoid (Fragment)| Length = 54 Score = 28.9 bits (63), Expect = 5.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y+ KC CN Sbjct: 17 EYMPLCGSDNKTYDNKCNFCN 37
>KSGA_MYCTU (P66660) Dimethyladenosine transferase (EC 2.1.1.-)| (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) Length = 317 Score = 28.9 bits (63), Expect = 5.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 273 PCTHGDTRSYNRKCRLCNTRGGMEEGCCSGSNFQWPGCSGH 151 P G+T S + RL GG +E +G + + P SGH Sbjct: 273 PARRGETLSIDDFVRLLRRSGGSDEATSTGRDARAPDISGH 313
>KSGA_MYCBO (P66661) Dimethyladenosine transferase (EC 2.1.1.-)| (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) Length = 317 Score = 28.9 bits (63), Expect = 5.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 273 PCTHGDTRSYNRKCRLCNTRGGMEEGCCSGSNFQWPGCSGH 151 P G+T S + RL GG +E +G + + P SGH Sbjct: 273 PARRGETLSIDDFVRLLRRSGGSDEATSTGRDARAPDISGH 313
>IPSG_UNCUN (P81262) Double-headed protease inhibitor, submandibular gland| Length = 122 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 318 DCRGECGVKNSD----EYLPCTHGDTRSYNRKCRLCN 220 +C EC + SD EYLP D ++Y+ KC CN Sbjct: 67 ECDIEC-TQYSDMCTMEYLPLCGSDGKNYSNKCLFCN 102
>IPSG_MARMT (P81482) Double-headed protease inhibitor, submandibular gland| Length = 122 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 318 DCRGECGVKNSD----EYLPCTHGDTRSYNRKCRLCN 220 +C EC + SD EYLP D ++Y+ KC CN Sbjct: 67 ECDIEC-TQYSDMCTMEYLPLCGSDGKNYSNKCLFCN 102
>PCSK5_BRACL (Q9NJ15) Proprotein convertase subtilisin/kexin type 5 precursor (EC| 3.4.21.-) (Proprotein convertase PC6-like) (aPC6) Length = 1696 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -3 Query: 306 ECGVKNSDEYLPCTHGDTRSYNRKC-RLCNTRGGMEEGCCSGSNFQWPGCSG 154 +C +D+ L C H DT Y+ C + C R E G C + GC G Sbjct: 883 KCNGSQADQCLEC-HHDTNLYDTTCVQYCGNRRYPENGECHPCHPSCLGCIG 933
>IOVO_POLRA (P68375) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_OXYVI (P68132) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_OXYJA (P68131) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_OPIHO (P52249) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y+ KC CN Sbjct: 17 EYMPLCGSDNKTYDNKCSFCN 37
>IOVO_NETRU (P68392) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_NECMO (P68377) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_LOPIG (P67894) Ovomucoid (Fragment)| Length = 56 Score = 28.5 bits (62), Expect = 7.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY P D +SY+ KC CN Sbjct: 19 EYRPLCGSDNKSYDNKCNFCN 39
>IOVO_LOPDI (P67893) Ovomucoid (Fragment)| Length = 56 Score = 28.5 bits (62), Expect = 7.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY P D +SY+ KC CN Sbjct: 19 EYRPLCGSDNKSYDNKCNFCN 39
>IOVO_HALIN (P05577) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_HALAL (P52268) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_GYPCO (P68374) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_GUIGU (P52246) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_DENEY (P05569) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_DENBI (P67892) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_DENAU (P67891) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_DENAR (P67889) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_DENAC (P67890) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_CYGOL (P68130) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_CYGAT (P68129) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_CIRAE (P05579) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_CERNO (P05575) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_BRACA (P68393) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_AYTAM (P68391) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>IOVO_AQUAU (P68376) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D+++Y+ KC CN Sbjct: 17 EYMPLCGSDSKTYSNKCDFCN 37
>IOVO_ANSSE (P05567) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y+ KC CN Sbjct: 17 EYMPLCGSDNQTYSNKCNFCN 37
>IOVO_ANSCA (P68394) Ovomucoid (Fragment)| Length = 54 Score = 28.5 bits (62), Expect = 7.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 17 EYMPLCGSDNKTYGNKCNFCN 37
>HERC2_MOUSE (Q4U2R1) HECT domain and RCC1-like domain-containing protein 2| Length = 4836 Score = 28.5 bits (62), Expect = 7.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 276 NIHPSF*PRTLLCNLSDLLCFDLGLHLDFL 365 NIHP+ T + NL LC +G+H D + Sbjct: 1957 NIHPTAMMLTSVINLLQTLCLSVGVHADIM 1986
>OPGH_RALSO (Q8XVC2) Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)| Length = 862 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 206 WRKVAALGLIFNGLVAQVTYEQDISP 129 WR A+G +F+G A V YEQ SP Sbjct: 149 WRARRAIGRLFSGGTAPVPYEQPDSP 174
>IOVO_VANSP (P68384) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 +Y+P D+++Y+ KC CN Sbjct: 17 DYMPLCGSDSKTYSNKCNFCN 37
>IOVO_STRCA (P05557) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 +Y+P D+++Y+ KC CN Sbjct: 17 DYMPLCGSDSKTYSNKCNFCN 37
>IOVO_PODST (P52264) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 +Y+P D+++Y+ KC CN Sbjct: 17 DYMPLCGSDSKTYSNKCNFCN 37
>IOVO_LARRI (P68386) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 +Y+P D+++Y+ KC CN Sbjct: 17 DYMPLCGSDSKTYSNKCNFCN 37
>IOVO_LARMA (P68385) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 +Y+P D+++Y+ KC CN Sbjct: 17 DYMPLCGSDSKTYSNKCNFCN 37
>IOVO_CYRMO (P05592) Ovomucoid (Fragment)| Length = 56 Score = 28.1 bits (61), Expect = 9.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y KC CN Sbjct: 19 EYVPICGSDNKTYGNKCNFCN 39
>IOVO_CHATO (P67888) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y+ KC CN Sbjct: 17 EYMPLCGSDNQTYSNKCSFCN 37
>IOVO_CHACH (P67887) Ovomucoid (Fragment)| Length = 54 Score = 28.1 bits (61), Expect = 9.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 282 EYLPCTHGDTRSYNRKCRLCN 220 EY+P D ++Y+ KC CN Sbjct: 17 EYMPLCGSDNQTYSNKCSFCN 37
>NOTC1_RAT (Q07008) Neurogenic locus notch homolog protein 1 precursor (Notch| 1) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +3 Query: 204 PFHLWCCKDGI----CDCKTEYR-HECKVNIH 284 P H+ CKDG+ C C+ Y H C+ NI+ Sbjct: 574 PCHIGLCKDGVATFTCLCQPGYTGHHCETNIN 605
>RS3_CLOTE (Q890P3) 30S ribosomal protein S3| Length = 222 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 371 NNEEIKVKAKIEAQKVREIAEESAGSKTRMNIYLA 267 NN VK K+ A + +I E AG + ++NIY A Sbjct: 37 NNIRNFVKKKVYAAGISKIEIERAGKRVKLNIYTA 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,999,567 Number of Sequences: 219361 Number of extensions: 1154206 Number of successful extensions: 3511 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 3411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3509 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)