| Clone Name | rbasd25k13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 12KD_FRAAN (Q05349) Auxin-repressed 12.5 kDa protein | 49 | 3e-06 | 2 | POLS_SFV (P03315) Structural polyprotein (p130) [Contains: Capsi... | 27 | 9.7 | 3 | MURA_HAEIN (P45025) UDP-N-acetylglucosamine 1-carboxyvinyltransf... | 27 | 9.7 | 4 | KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-as... | 27 | 9.7 |
|---|
>12KD_FRAAN (Q05349) Auxin-repressed 12.5 kDa protein| Length = 111 Score = 48.9 bits (115), Expect = 3e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 337 GANLFDRPQPNSPTVYDWLYSDETRTR 257 G +FD PQPNSPTVYDW+YS ETR++ Sbjct: 82 GNQVFDSPQPNSPTVYDWMYSGETRSK 108
>POLS_SFV (P03315) Structural polyprotein (p130) [Contains: Capsid protein (EC| 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike gly Length = 1253 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 8/49 (16%) Frame = +3 Query: 12 STHIHPSLASMRRAKSKLR*QKKVT--------STSIVVLLSLGETTCS 134 S H H ++A+++ A +K++ KVT S S VV L TCS Sbjct: 1144 SVHSHSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCS 1192
>MURA_HAEIN (P45025) UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC| 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) Length = 424 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 121 KLHAASDSNVRTQDLDXXKSSKHGVVPDRSCRSSTPVFLFFSGGC 255 K+ A +++ + ++ +H VVPDR + + SGGC Sbjct: 206 KITGAGSAHITIEGVERLTGCEHSVVPDRIETGTFLIAAAISGGC 250
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 200 GTTPCLLLFXXSKSCVRTLLSEAAC 126 GT PCL L SCV + +AAC Sbjct: 32 GTAPCLTLVCTPVSCVSSPCCQAAC 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,638,422 Number of Sequences: 219361 Number of extensions: 558565 Number of successful extensions: 1258 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)