| Clone Name | rbasd25j16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | US27_HCMVA (P09703) G-protein coupled receptor homolog US27 (HHRF2) | 28 | 9.2 |
|---|
>US27_HCMVA (P09703) G-protein coupled receptor homolog US27 (HHRF2)| Length = 362 Score = 27.7 bits (60), Expect = 9.2 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 23 LYNIMCMCIYIATDSIHIRACFLEPCWYMNMGIHTFLGT 139 L N++ C+Y+ ++RAC +N GI+ +GT Sbjct: 268 LQNVIIFCLYVGQFLAYVRAC-------LNPGIYILVGT 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,816,903 Number of Sequences: 219361 Number of extensions: 273899 Number of successful extensions: 832 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)