| Clone Name | rbasd25i05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HRK1_YEAST (Q08732) Serine/threonine-protein kinase HRK1 (EC 2.7... | 30 | 2.9 | 2 | MEFV_MOUSE (Q9JJ26) Pyrin (Marenostrin) | 30 | 2.9 | 3 | KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-ass... | 29 | 6.5 | 4 | TNAB_PROVU (P28785) Low affinity tryptophan permease | 29 | 8.5 |
|---|
>HRK1_YEAST (Q08732) Serine/threonine-protein kinase HRK1 (EC 2.7.11.1)| (Hygromycin resistance kinase 1) Length = 759 Score = 30.4 bits (67), Expect = 2.9 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +3 Query: 24 STTPLYYNTAN*NYSENMVHNEHFSISA*KYSSCWEPEYGVNITAGVPDYT 176 +TT Y T N N + + H+ SIS Y++ +E + NI+ G+ DYT Sbjct: 63 TTTTTNYTTTNLNNNTHS-HSNATSISTNNYNNNYETNHHHNISHGLHDYT 112
>MEFV_MOUSE (Q9JJ26) Pyrin (Marenostrin)| Length = 767 Score = 30.4 bits (67), Expect = 2.9 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +1 Query: 337 AGGAWARCAPCGCLHLTCLCHRSSTRNSPQCEGRRMEQLLLLICPE 474 A G + C C L C S ++ PQC R M+Q+LLL C + Sbjct: 414 ASGRCSICFQCQGLLARKSCEAQSPQSLPQCP-RHMKQVLLLFCED 458
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 29.3 bits (64), Expect = 6.5 Identities = 20/61 (32%), Positives = 25/61 (40%), Gaps = 10/61 (16%) Frame = +1 Query: 280 CGESISLQLQHPSSCWSRGA--------GGAWARCAPCGCLHLTCL--CHRSSTRNSPQC 429 CG S + + SSC S G GG+ C CGC +C C SS S C Sbjct: 87 CGSSCCVPVCCSSSCGSCGGSKGVCGFRGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCC 146 Query: 430 E 432 + Sbjct: 147 Q 147
>TNAB_PROVU (P28785) Low affinity tryptophan permease| Length = 417 Score = 28.9 bits (63), Expect = 8.5 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = -3 Query: 191 YICLMSIIRNSGGYIYSVFRFPTATVLLGTDAEVLVVYHVFTVILISSVVI*GCCAS 21 YI + + I +G IY A++L G + + ++ +FT+ L +++ G CAS Sbjct: 99 YILIYAYISAAGSIIYE------ASLLYGINFNLRAIFFIFTIALGATIWWGGACAS 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,553,159 Number of Sequences: 219361 Number of extensions: 1119486 Number of successful extensions: 2609 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2608 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)