| Clone Name | rbasd25e18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ROBO2_HUMAN (Q9HCK4) Roundabout homolog 2 precursor | 32 | 0.79 | 2 | ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor | 30 | 3.9 | 3 | VP30_MABVP (P41326) Minor nucleoprotein VP30 (VP5) | 30 | 5.1 | 4 | SLU7_CRYNE (Q5KII3) Pre-mRNA-splicing factor SLU7 | 30 | 5.1 | 5 | REC8L_HUMAN (O95072) Meiotic recombination protein REC8-like 1 (... | 29 | 6.7 |
|---|
>ROBO2_HUMAN (Q9HCK4) Roundabout homolog 2 precursor| Length = 1378 Score = 32.3 bits (72), Expect = 0.79 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 166 YSDADQNKSSNIPRNGSKEKANNEQKPTHAKATAW 270 YS DQNK +N + G K+K N KP + W Sbjct: 1035 YSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTW 1069
>ROBO2_MOUSE (Q7TPD3) Roundabout homolog 2 precursor| Length = 1470 Score = 30.0 bits (66), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 166 YSDADQNKSSNIPRNGSKEKANNEQKPTHAKATAW 270 YS DQNK +N + G K+K N K + W Sbjct: 1039 YSLPDQNKGNNGGKGGKKKKTKNSSKAQKNNGSTW 1073
>VP30_MABVP (P41326) Minor nucleoprotein VP30 (VP5)| Length = 281 Score = 29.6 bits (65), Expect = 5.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +2 Query: 161 SCTRTQIRTKAPTYHGMAAKKKPIMNRNQPMPRPQHGRRRILTGLPST 304 S TR+ + +PT H A+ P N ++P P P+ R + GLP T Sbjct: 42 SSTRSSAES-SPTNHIPRARPPPTFNLSKPPPPPKDMCRNMKIGLPCT 88
>SLU7_CRYNE (Q5KII3) Pre-mRNA-splicing factor SLU7| Length = 574 Score = 29.6 bits (65), Expect = 5.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 265 LWPWHGLVSVHYWLFLCCHSVVCWSFCS 182 +W + +S W F CCHSV+ S+C+ Sbjct: 410 IWGSYYDLSTSQWGFACCHSVLPGSYCT 437
>REC8L_HUMAN (O95072) Meiotic recombination protein REC8-like 1 (Cohesin Rec8p)| Length = 547 Score = 29.3 bits (64), Expect = 6.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 514 PVRHLRGPVRLRRVPAAGGRVPPACSAAW 428 P R +RGP L R P G +PP W Sbjct: 338 PERTIRGPAELFRTPTLSGWLPPELLGLW 366 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,448,762 Number of Sequences: 219361 Number of extensions: 849700 Number of successful extensions: 2753 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2752 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)