ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd24o23 |
|---|---|
| Clone Library Name | barley_pub |
>ERR2_HUMAN (O95718) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) (ERR beta-2) Length = 500 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 137 YSCPATNECEITKRRRKSCQACR 159
>ERR1_HUMAN (P11474) Steroid hormone receptor ERR1 (Estrogen-related receptor,| alpha) (ERR-alpha) (Estrogen receptor-like 1) Length = 519 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 210 YSCPASNECEITKRRRKACQACR 232
>ERR3_PONPY (Q5RAM2) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) Length = 435 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 139 YSCPATNECEITKRRRKSCQACR 161
>ERR1_MOUSE (O08580) Steroid hormone receptor ERR1 (Estrogen-related receptor,| alpha) (ERR-alpha) (Estrogen receptor-like 1) (Fragment) Length = 462 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 153 YSCPASNECEITKRRRKACQACR 175
>ERR3_RAT (P62510) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) Length = 458 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 162 YSCPATNECEITKRRRKSCQACR 184
>ERR3_MOUSE (P62509) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) Length = 458 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 162 YSCPATNECEITKRRRKSCQACR 184
>ERR3_HUMAN (P62508) Estrogen-related receptor gamma (Estrogen receptor-related| protein 3) (ERR gamma-2) Length = 458 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 162 YSCPATNECEITKRRRKSCQACR 184
>ERR2_RAT (P11475) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) Length = 433 Score = 30.0 bits (66), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 +SCP + C+I RR C CR Sbjct: 137 YSCPATNECEITKRRRKSCQACR 159
>S28A1_PIG (O62667) Sodium/nucleoside cotransporter 1 (Na(+)/nucleoside| cotransporter 1) (Sodium-coupled nucleoside transporter 1) (Concentrative nucleoside transporter 1) (CNT 1) Length = 647 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 368 EIGGFAYEIICKPPVSPVTLAFPKRWLGCPVVL-LSRVRLMPNXDPSVERLFGLQK 204 ++ G ++++IC + PV W CPVV L ++L N + + L G ++ Sbjct: 453 DVQGLSFQLICSYVLRPVAFLMGVAWEDCPVVAELLGMKLFLNEFVAYQELSGYKQ 508
>VGLH_EHV4 (P24430) Glycoprotein H precursor| Length = 855 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 261 TGQENDGTSEPTFGKSKGYGRNGRFAYDF 347 TG E+DGT+ ++G+S N R AY+F Sbjct: 622 TGLEDDGTTIHSYGRSANGILNSRIAYNF 650
>TNC6B_HUMAN (Q9UPQ9) Trinucleotide repeat-containing 6B protein| Length = 1723 Score = 28.9 bits (63), Expect = 5.2 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +1 Query: 175 PDRVRTRYVLFCNPNSRSTDGSXFGMSRTRDRRTTGHPSQRLGKARVTGETG 330 P T + +PN G FGM R+T PSQ G R TG G Sbjct: 373 PKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGD-RKTGSVG 423
>ERR2_MOUSE (Q61539) Steroid hormone receptor ERR2 (Estrogen-related receptor,| beta) (ERR-beta) (Estrogen receptor-like 2) Length = 433 Score = 28.9 bits (63), Expect = 5.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR 206 ++CP + C+I RR C CR Sbjct: 137 YNCPATNECEITKRRRKSCQACR 159
>C71E1_SORBI (O48958) Cytochrome P450 71E1 (EC 1.14.13.68)| (4-hydroxyphenylacetaldehyde oxime monooxygenase) Length = 531 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -1 Query: 302 PKRWLGCPVVLLSRVRLMPNXDPSVERLFGLQKSTYRVRTRSGRCDLVPRCPVGP 138 P++W C +VLL P + + L S R R+RSG+ PR P GP Sbjct: 15 PQQWQTCLLVLL----------PVLLVSYYLLTSRSRNRSRSGKLGGAPRLPPGP 59
>S28A1_RAT (Q62674) Sodium/nucleoside cotransporter 1 (Na(+)/nucleoside| cotransporter 1) (Sodium-coupled nucleoside transporter 1) (Concentrative nucleoside transporter 1) (CNT 1) Length = 648 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 368 EIGGFAYEIICKPPVSPVTLAFPKRWLGCPVV 273 +I G ++++IC + PV W CPVV Sbjct: 454 DIQGLSFQLICSYVLRPVAFLMGVAWEDCPVV 485
>VGLH_EHV1B (Q6DLH1) Glycoprotein H precursor| Length = 848 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 261 TGQENDGTSEPTFGKSKGYGRNGRFAYDF 347 TG E+DGT+ ++G+S N R AY+F Sbjct: 615 TGFEDDGTTIHSYGRSANGILNSRIAYNF 643
>VGLH_EHV1 (P68330) Glycoprotein H precursor| Length = 848 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 261 TGQENDGTSEPTFGKSKGYGRNGRFAYDF 347 TG E+DGT+ ++G+S N R AY+F Sbjct: 615 TGFEDDGTTIHSYGRSANGILNSRIAYNF 643
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 211 NPNSRSTDGSXFGMSRTRDRRTTGHPSQRLGKARVTGETGGL 336 N RS D G+SR R R + G + +G+ R G GG+ Sbjct: 310 NQYRRSKDSRGRGLSRGRGRGSRGGRGKGMGRGRGRGGRGGM 351
>Y1409_HAEIN (P44183) Hypothetical protein HI1409| Length = 436 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +3 Query: 207 LQPEQPFDRRIXI--WHESYTGQENDGTSEPTFGKSKGYGRNG 329 LQP + R I + W S TGQ +D P FG+ Y G Sbjct: 118 LQPTERLKRLIILPKWKISPTGQRDDDVFSPNFGRYSEYTITG 160
>ESR2_RAT (Q62986) Estrogen receptor beta (ER-beta)| Length = 530 Score = 28.1 bits (61), Expect = 8.8 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 12/81 (14%) Frame = -2 Query: 274 FSCPVYDSCQIXIRRSNGCSGCR-----KVRIVSAHGQVDVISCRVV-------PSVPCM 131 + CP + C I R C CR +V +V + + R+V V C+ Sbjct: 183 YICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCL 242 Query: 130 NRAKF*SDGPRAVRVAEKYVS 68 ++AK +G A RV E +S Sbjct: 243 SKAK--RNGGHAPRVKELLLS 261
>TOP3B_MOUSE (Q9Z321) DNA topoisomerase 3-beta-1 (EC 5.99.1.2) (DNA| topoisomerase III beta-1) Length = 862 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 184 VRTRYVLFCNPNSRSTDGSXFGMSRTRDRRTTGHPSQRLGKARVT 318 V ++ C+P R G G R R RR G P+ R K +++ Sbjct: 811 VELKHAASCHPMHRGGPGRRQGRGRGRGRRPPGKPNPRRPKDKMS 855
>THA10_PONPY (Q5NVM3) THAP domain-containing protein 10| Length = 264 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 152 CPVGPVYESCQILIRRPKGRS 90 C GPV++S QI ++RP+ RS Sbjct: 178 CEEGPVHKSTQISLKRPRHRS 198
>THA10_HUMAN (Q9P2Z0) THAP domain-containing protein 10| Length = 257 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 152 CPVGPVYESCQILIRRPKGRS 90 C GPV++S QI ++RP+ RS Sbjct: 171 CEEGPVHKSTQISLKRPRHRS 191
>S28A2_MOUSE (O88627) Sodium/nucleoside cotransporter 2 (Na(+)/nucleoside| cotransporter 2) (Sodium-coupled nucleoside transporter 2) (Concentrative nucleoside transporter 2) (CNT 2) (Sodium/purine nucleoside cotransporter) (SPNT) Length = 660 Score = 28.1 bits (61), Expect = 8.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -1 Query: 368 EIGGFAYEIICKPPVSPVTLAFPKRWLGCPVV 273 +I G ++++IC + P+ +W CP+V Sbjct: 451 DIHGLSFQVICSYVLRPMVFMMGVQWADCPLV 482
>S28A1_HUMAN (O00337) Sodium/nucleoside cotransporter 1 (Na(+)/nucleoside| cotransporter 1) (Sodium-coupled nucleoside transporter 1) (Concentrative nucleoside transporter 1) (CNT 1) (hCNT1) Length = 649 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 368 EIGGFAYEIICKPPVSPVTLAFPKRWLGCPVV 273 +I G ++++IC + PV W CPVV Sbjct: 454 DIQGLSFQLICSYILRPVAFLMGVAWEDCPVV 485
>ZP4_FELCA (P48834) Zona pellucida sperm-binding protein 4 precursor (Zona| pellucida sperm-binding protein B) Length = 570 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 143 GPVYESCQILIRRPKGRSGCR 81 GPVY C + I +P G S CR Sbjct: 470 GPVYLHCNVSICQPAGTSSCR 490 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,591,166 Number of Sequences: 219361 Number of extensions: 1448692 Number of successful extensions: 3968 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3967 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
