| Clone Name | rbasd24o09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KSGA_COXBU (Q83AC2) Dimethyladenosine transferase (EC 2.1.1.-) (... | 31 | 3.1 | 2 | WRK49_ARATH (Q9FHR7) Probable WRKY transcription factor 49 (WRKY... | 30 | 5.4 |
|---|
>KSGA_COXBU (Q83AC2) Dimethyladenosine transferase (EC 2.1.1.-)| (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) Length = 255 Score = 31.2 bits (69), Expect = 3.1 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +3 Query: 612 TEHPLQIVRSLPSERSCPLLFSFF--IHCL 695 T+ PL++V +LP S PLLF F IHC+ Sbjct: 94 TDKPLRVVGNLPYNISTPLLFHLFSQIHCI 123
>WRK49_ARATH (Q9FHR7) Probable WRKY transcription factor 49 (WRKY DNA-binding| protein 49) Length = 274 Score = 30.4 bits (67), Expect = 5.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 506 LHKHSVQSMNQRSETFHSSNTFQKGSIFN 592 +HKH+ Q MN++S+T S Q G + N Sbjct: 191 IHKHNAQDMNKKSQTQEESKEAQLGELTN 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,908,469 Number of Sequences: 219361 Number of extensions: 1865911 Number of successful extensions: 4742 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4741 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)