| Clone Name | rbasd25d06 |
|---|---|
| Clone Library Name | barley_pub |
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 46.6 bits (109), Expect = 3e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = -1 Query: 370 KCCNNCR-SFSGVDVCDDAHPQCPKGCSACRV---VTPSPHKTFRCADMKSTVDGTCGGP 203 KCC NC SFSG+ CDD C C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 202 C 200 C Sbjct: 102 C 102
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 30.4 bits (67), Expect = 2.5 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 213 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHWGWASSQTST 338 Q+P T +FMSA N L TT E P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>ARHG6_HUMAN (Q15052) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) (PAK-interacting exchange factor alpha) (Alpha-Pix) (COOL-2) Length = 776 Score = 30.0 bits (66), Expect = 3.3 Identities = 28/90 (31%), Positives = 32/90 (35%), Gaps = 16/90 (17%) Frame = +3 Query: 12 TSNTSFFSRXVKHSDDKQRTYCW----------PYSTAHTQT*QHDDCSSHLSFILGGTP 161 T NT R V H ++ Q W P S + CS+H SF G P Sbjct: 519 TGNT--VERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQP 576 Query: 162 RPSL------KP*SDQCFLHGPPQVPSTVL 233 R L KP S C PP PS L Sbjct: 577 RGPLEPPQIIKPWSLSCLRPAPPLRPSAAL 606
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 367 CCNNCRSFSGVD-----VCDDAHPQCPKGCSACRVVTPSPHKTFRCAD 239 CCN C VC D CP C++C V T S RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSC-VCTRSNPPQCRCTD 57
>DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3)| Length = 347 Score = 29.6 bits (65), Expect = 4.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 157 VPPRIKLR*DEQSSCCYVCVWAVLYGQQYVRCLSSLC 47 +PPR++ +EQ S C +C+ + + +C S C Sbjct: 149 LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFC 185
>ARHG6_RAT (Q5XXR3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 772 Score = 29.6 bits (65), Expect = 4.3 Identities = 26/86 (30%), Positives = 30/86 (34%), Gaps = 16/86 (18%) Frame = +3 Query: 24 SFFSRXVKHSDDKQRTYCW----------PYSTAHTQT*QHDDCSSHLSFILGGTPRPSL 173 S R V H ++ Q W P S + CS+H SF G PR L Sbjct: 521 STVERIVVHCNNNQDFQEWMEQLNRLTKGPASCSSLSKTSSSSCSTHSSFSSTGQPRGPL 580 Query: 174 ------KP*SDQCFLHGPPQVPSTVL 233 KP S C PP PS L Sbjct: 581 EPPQIIKPWSLSCLRPAPPLRPSAAL 606
>ARHG6_MOUSE (Q8K4I3) Rho guanine nucleotide exchange factor 6 (Rac/Cdc42| guanine nucleotide exchange factor 6) Length = 771 Score = 29.3 bits (64), Expect = 5.6 Identities = 26/86 (30%), Positives = 29/86 (33%), Gaps = 16/86 (18%) Frame = +3 Query: 24 SFFSRXVKHSDDKQRTYCW----------PYSTAHTQT*QHDDCSSHLSFILGGTPRPSL 173 S R V H ++ Q W P S CS+H SF G PR L Sbjct: 520 STVERIVVHCNNNQDFQEWMEQLNRLTKGPTSCGSLSKTSSSSCSTHSSFSSTGQPRGPL 579 Query: 174 ------KP*SDQCFLHGPPQVPSTVL 233 KP S C PP PS L Sbjct: 580 EPPQIIKPWSLSCLRPAPPLRPSAAL 605
>POMT1_DROME (Q9VTK2) Protein O-mannosyltransferase 1 (EC 2.4.1.109)| (Dolichyl-phosphate-mannose--protein mannosyltransferase 1) (dPOMT1) (Protein rotated abdomen) Length = 886 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 373 PKCCNNCRSFSGVDVCDD--AHPQCPKGCSACRVVTPSPHKT 254 P CCN R+ + ++ C D H P S R TP+P T Sbjct: 61 PLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPTPT 102
>RECQ5_HUMAN (O94762) ATP-dependent DNA helicase Q5 (EC 3.6.1.-) (RecQ| protein-like 5) (RecQ5) Length = 991 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -1 Query: 355 CRSFSGVDVCDDAHPQCPKGCSACRVVTPSPHKTFRCADMKSTVDGTCGGP 203 CR + DA P C KGC C+ T + + + S+ TC GP Sbjct: 411 CRHAAIAKYFGDALPACAKGCDHCQNPT-AVRRRLEALERSSSWSKTCIGP 460
>ZPBP1_HUMAN (Q9BS86) Zona pellucida-binding protein 1 precursor (Sp38)| Length = 351 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -1 Query: 352 RSFSGVDVCDDAHPQCPKGCSACRVVTPSPHKTFRCADMKSTV 224 R F G + HP+CP+ C C + +P C S++ Sbjct: 301 RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSL 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,810,541 Number of Sequences: 219361 Number of extensions: 961289 Number of successful extensions: 2598 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2595 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)