| Clone Name | rbasd25b24 |
|---|---|
| Clone Library Name | barley_pub |
>MAVS_RAT (Q66HG9) Mitochondrial antiviral signaling protein (Interferon-beta| promoter stimulator protein 1) (IPS-1) (Virus-induced signaling adapter) Length = 507 Score = 32.0 bits (71), Expect = 1.0 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Frame = +1 Query: 277 LNRQDYWVVLSAFSLCDCELKGLTRYSSSSAQLHIPPG-----------PRTPATLSQSS 423 L R+ WV + +L CEL GL + Q ++PPG PR P T+S+ S Sbjct: 62 LQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEPS 121
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 31.6 bits (70), Expect = 1.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -1 Query: 497 AKEFGVIDKILWRGQEKYMSDMLSPEDWDKVAG 399 A+EFG+I K LW GQ +Y +SP+D+ G Sbjct: 789 AEEFGIIMKALWTGQYRY----ISPKDFKVTIG 817
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 31.2 bits (69), Expect = 1.8 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -1 Query: 497 AKEFGVIDKILWRGQEKYMSDMLSPEDWDKVAG 399 A+EFG+I K LW GQ +Y +SP+D+ G Sbjct: 827 AEEFGIIMKALWTGQYRY----ISPKDFKITIG 855
>COFA1_HUMAN (P39059) Collagen alpha-1(XV) chain precursor [Contains: Endostatin| (Endostatin-XV) (Restin) (Related to endostatin)] Length = 1388 Score = 29.3 bits (64), Expect = 6.8 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 5/36 (13%) Frame = +1 Query: 340 GLTRYSSSSAQLHIPPGPRTPATL-----SQSSGES 432 GL R++ S QL + P PRTP L S +SGE+ Sbjct: 211 GLERFTGSLQQLTVHPDPRTPEELCDPEESSASGET 246
>CLPP_HELPY (P56156) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 29.3 bits (64), Expect = 6.8 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -1 Query: 518 FYMDSLKAKEFGVIDKIL 465 FYM + +AKE+G+IDK+L Sbjct: 174 FYMSAKEAKEYGLIDKVL 191
>PHLPL_MOUSE (Q8BXA7) PH domain leucine-rich repeat protein phosphatase-like (EC| 3.1.3.16) Length = 1320 Score = 29.3 bits (64), Expect = 6.8 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 322 CDCELKGLTRYS----SSSAQLHIPPGPRTPATLSQSSGESMSDM 444 C CE+ GLT +S+A L P P TP++ S + E S+M Sbjct: 1037 CTCEMNGLTLPGPVGFASTAALKDTPKPTTPSSSSGIASEFSSEM 1081
>GSCR1_HUMAN (Q9NZM4) Glioma tumor suppressor candidate region gene 1 protein| Length = 1509 Score = 29.3 bits (64), Expect = 6.8 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = +2 Query: 392 LGLQQP-------CPNPQGRACPTCTSPDRAKGSCQLPQTPWLSKSP 511 LGLQQP P PQ A P T+P + G P+ L + P Sbjct: 586 LGLQQPQAQQPPQAPTPQAAAPPQATTPQPSPGLASSPEKIVLGQPP 632
>CLPP_HELPJ (Q9ZL50) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 29.3 bits (64), Expect = 6.8 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -1 Query: 518 FYMDSLKAKEFGVIDKIL 465 FYM + +AKE+G+IDK+L Sbjct: 173 FYMSAKEAKEYGLIDKVL 190
>CLPP_GEOKA (Q5KVD9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 28.9 bits (63), Expect = 8.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 515 YMDSLKAKEFGVIDKILWRGQEK 447 +M + KA E+G+ID++L R EK Sbjct: 174 FMTAQKAMEYGIIDRVLTRADEK 196
>AHM1_ARATH (Q9M3H5) Putative cadmium/zinc-transporting ATPase HMA1,| chloroplast precursor (EC 3.6.3.3) (EC 3.6.3.5) Length = 819 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 64 TIAPPKTLARSYPERIRSSSNLLP 135 +I PPKTL R P RI +S NL P Sbjct: 33 SILPPKTLLRQKPLRISASLNLPP 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,297,050 Number of Sequences: 219361 Number of extensions: 1534793 Number of successful extensions: 4337 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4337 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)