| Clone Name | rbasd25a05 |
|---|---|
| Clone Library Name | barley_pub |
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 31.2 bits (69), Expect = 2.4 Identities = 22/71 (30%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = +3 Query: 219 SIAIDPGCGHSLLHAISLINIASCTRCGVRRFFIRLICCCSS*YLPRCGESMRFTPSC-- 392 S+ D GCG L T C R R CC SS P+C +S+ P+C Sbjct: 8 SVCSDQGCGQVLCQETCCRPSCCQTTC-CRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCR 66 Query: 393 -PCSKMQFSHP 422 C + HP Sbjct: 67 PSCCETTCCHP 77
>GP157_HUMAN (Q5UAW9) Probable G-protein coupled receptor 157| Length = 335 Score = 31.2 bits (69), Expect = 2.4 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +3 Query: 195 GGRCLRLPSIAIDPGCGHSLLHAISLINIASCTRCGVRRFFIRLICCCSS 344 G ++ P + + G G++ + I CTR R F CCCSS Sbjct: 251 GSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSS 300
>AREA_PENRO (O13508) Nitrogen regulatory protein areA (Nitrogen regulator nmc)| Length = 860 Score = 30.4 bits (67), Expect = 4.0 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 364 ASR*GSLRHAPAAKCNFRIQSIHSPASMNG 453 +SR S++HAP+ + R+ + SP SMNG Sbjct: 726 SSRKNSIQHAPSTSISSRMNTSESPPSMNG 755
>LAMB3_HUMAN (Q13751) Laminin beta-3 chain precursor (Laminin 5 beta 3) (Laminin| B1k chain) (Kalinin B1 chain) Length = 1172 Score = 29.6 bits (65), Expect = 6.9 Identities = 20/69 (28%), Positives = 28/69 (40%) Frame = +3 Query: 192 EGGRCLRLPSIAIDPGCGHSLLHAISLINIASCTRCGVRRFFIRLICCCSS*YLPRCGES 371 E GRCL LP++ + P C + L + C C C + P+C + Sbjct: 447 ESGRCLCLPNV-VGPKCDQCAPYHWKLASGQGCEPCA---------CDPHNSLSPQCNQ- 495 Query: 372 MRFTPSCPC 398 FT CPC Sbjct: 496 --FTGQCPC 502
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 29.6 bits (65), Expect = 6.9 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = +3 Query: 219 SIAIDPGCGHSLLHAISLINIASCTRCGVRRFFIRLICCCSS*YLPRCGESMRFTPSC 392 S+ GCG L + + C R + R CC SS P+C +S+ P+C Sbjct: 8 SVCSHQGCGQDLCQE-TCCRPSCCETTCCRTTYCRPSCCVSSCCRPQCCQSVCCQPTC 64
>VIPR2_RAT (P35000) Vasoactive intestinal polypeptide receptor 2 precursor| (VIP-R-2) (Pituitary adenylate cyclase-activating polypeptide type III receptor) (PACAP type III receptor) (PACAP-R-3) Length = 437 Score = 29.6 bits (65), Expect = 6.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 202 LPPSLVFYYYLLLSANQ*AVCLWSWVWTGMSTQ 104 LPPS F YLL+ +VC+ +W+ T +S + Sbjct: 234 LPPSRCFLAYLLIGWGIPSVCIGAWIATRLSLE 266
>HUNB_DROVI (P13361) Protein hunchback| Length = 816 Score = 29.3 bits (64), Expect = 9.0 Identities = 19/65 (29%), Positives = 25/65 (38%) Frame = +2 Query: 95 QHLLGGHSSPNPTPQAHCLLIC*QQQIIVKDKGGREVPPFAIDSNRSRLWSQPSSCHQLN 274 QH GG+ P+P P I DK PP + +S SQ SS Sbjct: 163 QHYYGGNMRPSPQPTPTAAPTAVAAAIQTGDKLQALTPPMDVTPPKSPAKSQQSSAEPEK 222 Query: 275 QHRLL 289 +H L+ Sbjct: 223 EHDLM 227 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,749,494 Number of Sequences: 219361 Number of extensions: 1535689 Number of successful extensions: 3250 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3246 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)