| Clone Name | rbasd24j05 |
|---|---|
| Clone Library Name | barley_pub |
>CHIT1_TULBA (Q9SLP4) Chitinase 1 precursor (EC 3.2.1.14) (Tulip bulb| chitinase-1) (TBC-1) Length = 314 Score = 59.3 bits (142), Expect = 4e-09 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = -1 Query: 423 VQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQGIAAAKELLR-QNKLPGFFI 247 V+ ++ +++ Q+ Y G KVL S +T+ G L PD G A +L+ Q KL G F+ Sbjct: 221 VEQFLKYFEEQSSNYHGGKVLVSF----STDSSGGLKPDNGFFRACSILKKQGKLHGIFV 276 Query: 246 WSADSSKQXDYKFTYETRAQEIVAN 172 WSAD S + F YE +AQ ++A+ Sbjct: 277 WSADDSLMSNNVFRYEMQAQSMLAS 301
>CHIT2_TULBA (Q7M443) Chitinase 2 (EC 3.2.1.14) (Tulip bulb chitinase-2) (TBC-2)| Length = 275 Score = 58.2 bits (139), Expect = 8e-09 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = -1 Query: 423 VQTYVMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQGIAAAKELLR-QNKLPGFFI 247 V+ ++ +++ Q YPG KVL S +T+ G L P G A +L+ Q KL G F+ Sbjct: 195 VEQFLKYFEMQRSNYPGGKVLVSF----STDNSGGLKPRNGFFDACSILKKQGKLHGIFV 250 Query: 246 WSADSSKQXDYKFTYETRAQEIVAN 172 WSAD S + F YE +AQ ++A+ Sbjct: 251 WSADDSLMSNDVFKYEMQAQSLLAS 275
>CARB_SYNY3 (Q55756) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 29.6 bits (65), Expect = 3.0 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = -1 Query: 411 VMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSP--DQGIAAAKELLRQNKLPG 256 V + + TG P AK+ + + +GKT EELG+ Q +A + +L +K PG Sbjct: 858 VPYVSKATGR-PLAKIASLVMSGKTLEELGVTEEFIPQHVAVKEAVLPFSKFPG 910
>KPRS_BACSU (P14193) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 317 Score = 29.3 bits (64), Expect = 3.9 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -1 Query: 405 FYDRQTGYYPGAKVLASLQTGKTTEELGLLSPDQ-GIAAAKELLRQNKLP 259 F+D + G +L GK E++ ++SPD G+ A++L + K P Sbjct: 143 FFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAP 192
>CARB_ANASP (Q8YQL2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1104 Score = 28.5 bits (62), Expect = 6.7 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -1 Query: 411 VMFYDRQTGYYPGAKVLASLQTGKTTEELGLLSP--DQGIAAAKELLRQNKLPG 256 V F + TG P AK+ + + +GKT EEL IA + +L NK PG Sbjct: 880 VPFVSKATGV-PLAKLASLIMSGKTLEELNFTQEVIPSHIAVKEAVLPFNKFPG 932
>FMT_RAT (Q5I0C5) Methionyl-tRNA formyltransferase, mitochondrial precursor| (EC 2.1.2.9) (MtFMT) Length = 385 Score = 28.1 bits (61), Expect = 8.8 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 291 PRRCLGPERAXPAPRWSCRS-ASWRAPWRRGS 383 PRRC GP A PR SC+S A + RR S Sbjct: 4 PRRCWGPWLAGRRPRCSCQSPAGFSGKDRRSS 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,502,595 Number of Sequences: 219361 Number of extensions: 787803 Number of successful extensions: 1894 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1893 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)