| Clone Name | rbasd24j03 |
|---|---|
| Clone Library Name | barley_pub |
>RNS1_ARATH (P42813) Ribonuclease 1 precursor (EC 3.1.27.1)| Length = 230 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQKFTCSDEILFHPF 214 ++C++ QLYQ+++CV LIECP C EI F F Sbjct: 184 VECNRDGSGNSQLYQVYLCVDRSGSGLIECPVFPHGKCGAEIEFPSF 230
>RNS3_ARATH (P42815) Ribonuclease 3 precursor (EC 3.1.27.1)| Length = 222 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQKFTCSDEILFHPF 214 I+C+K QLYQI++CV A I CP C + F F Sbjct: 176 IECNKDSSHNSQLYQIYLCVDTSASKFINCPVMPHGRCDSRVQFPKF 222
>RNLE_LYCES (P80022) Extracellular ribonuclease LE precursor (EC 3.1.27.1)| (RNase LE) Length = 230 Score = 37.0 bits (84), Expect = 0.012 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQKFTCSDEILFHPF 214 IQC+ QLYQ++ICV +LIECP C I F F Sbjct: 184 IQCNVDQSGNSQLYQVYICVDGSGSSLIECPIFPGGKCGTSIEFPTF 230
>RNLX_LYCES (P80196) Intracellular ribonuclease LX precursor (EC 3.1.27.1)| (RNase LX) Length = 237 Score = 34.7 bits (78), Expect = 0.059 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECP-KPQKFTCSDEILFHPF 214 I+C+ QLYQ+++CV A I+CP P C +I F F Sbjct: 181 IECNVDSQGNHQLYQVYLCVDSSASKFIDCPIFPHGGKCGSKIEFPSF 228
>RNDI_DICDI (Q7M438) Ribonuclease DdI precursor (EC 3.1.27.1) (RNase DdI)| Length = 223 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQKFTCSDEILF 223 IQCS G QL + +C+ +++ ++++CP Q ++CS + F Sbjct: 181 IQCSSG-----QLSTVAVCIDKNSLSIMDCPDLQGWSCSGSVKF 219
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 31.6 bits (70), Expect = 0.50 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 30 KEHNSMHILVRINYSLERNPQDEA*SATNLQL*LSIPWRRRPSQMLRQRTRR 185 K+ N M + + S +NP + +Q+ + + W R P+ LR TRR Sbjct: 1568 KQKNIMPLSAAMFLSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLRVETRR 1619
>RYR1_HUMAN (P21817) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5038 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 30 KEHNSMHILVRINYSLERNPQDEA*SATNLQL*LSIPWRRRPSQMLRQRTRR 185 K+ N M + + S +NP + +Q+ + + W R P+ L+ TRR Sbjct: 1567 KQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRR 1618
>DDX41_MOUSE (Q91VN6) Probable ATP-dependent RNA helicase DDX41 (EC 3.6.1.-)| (DEAD box protein 41) Length = 622 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = -2 Query: 178 VLCRSI*DGRRRHGILSYSCRLVADQASSCGLRSNE*LIRTSICMELCSFLFQM 17 ++C S R+ HGIL Y CRL+ + +S L+R ++C+ S QM Sbjct: 262 IICPSRELARQTHGILEYYCRLLQEDSSP--------LLRCALCIGGMSVKEQM 307
>DDX41_HUMAN (Q9UJV9) Probable ATP-dependent RNA helicase DDX41 (EC 3.6.1.-)| (DEAD box protein 41) (DEAD box protein abstrakt homolog) Length = 622 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = -2 Query: 178 VLCRSI*DGRRRHGILSYSCRLVADQASSCGLRSNE*LIRTSICMELCSFLFQM 17 ++C S R+ HGIL Y CRL+ + +S L+R ++C+ S QM Sbjct: 262 IICPSRELARQTHGILEYYCRLLQEDSSP--------LLRCALCIGGMSVKEQM 307
>RYR1_RABIT (P11716) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5037 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 30 KEHNSMHILVRINYSLERNPQDEA*SATNLQL*LSIPWRRRPSQMLRQRTRR 185 K+ N M + + S +NP + +Q+ + + W R P+ L+ TRR Sbjct: 1568 KQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVETRR 1619
>RNMC_MOMCH (P23540) Ribonuclease MC (EC 3.1.27.1) (RNase MC)| Length = 191 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 354 IQCSKGPFDKFQ-LYQIFICVAEDAKTLIECPKPQKFTCSDEILF 223 ++C P K L Q+ C A+D TLI+C + TC +F Sbjct: 150 LRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTRD---TCGANFIF 191
>RNS7_NICAL (Q40381) Ribonuclease S-7 precursor (EC 3.1.27.1) (Stylar| glycoprotein 7) (S7-RNase) Length = 218 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQ--KFTCSDEILF 223 + C+KG + L +I IC K +I CP P+ K T S+EI F Sbjct: 175 LSCTKGIME---LVEIGICFDSMVKNVINCPHPKTCKPTGSNEIKF 217
>RNS6_NICAL (Q40379) Ribonuclease S-6 precursor (EC 3.1.27.1) (Stylar| glycoprotein 6) (S6-RNase) Length = 215 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQKFTC 241 + C+KG +L+ + IC AK +I+CP P+ TC Sbjct: 173 LSCTKGQ----ELWFVGICFDSTAKNVIDCPNPK--TC 204
>XERC_CORGL (Q8NNZ9) Tyrosine recombinase xerC| Length = 308 Score = 27.7 bits (60), Expect = 7.2 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = +2 Query: 164 ASAKDTEDAACFSIHFLKGWKRISSEHVNFCGFGHSMSVLASSATQMKIWYSWNLSNGPL 343 A A ED FS+ L+ W I+ + G S + LA +K + SW NG L Sbjct: 53 AMADTIEDIDNFSLPTLRQWLGIAVDE------GKSRATLARRTASVKAFSSWAQKNGHL 106
>RNS11_NICAL (Q7SID5) Ribonuclease S-F11 (EC 3.1.27.1) (Stylar glycoprotein F11)| (SF11-RNase) Length = 196 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = -3 Query: 354 IQCSKGPFDKFQLYQIFICVAEDAKTLIECPKPQKFTCSDEILF 223 I+C++ +LY+I IC +A ++ CP+ + ++LF Sbjct: 151 IKCAEVTKGTPELYEIGICFTPNADSMFRCPQSDTCDKTAKVLF 194
>GMIP_HUMAN (Q9P107) GEM-interacting protein (GMIP)| Length = 970 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -2 Query: 301 LRGRGRQNAHRVPETAEVHVLRRDPLPPLQEVDAKAGRVLRVL 173 LRGRG A PE + LRR PLP E+ + R+L L Sbjct: 908 LRGRGPSPAAASPEGSP---LRRTPLPKHFEITQETARLLSKL 947 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,428,369 Number of Sequences: 219361 Number of extensions: 755356 Number of successful extensions: 2113 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2113 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)