| Clone Name | rbasd24f21 |
|---|---|
| Clone Library Name | barley_pub |
>EF1G2_ORYSA (Q6YW46) Elongation factor 1-gamma 2 (EF-1-gamma 2) (eEF-1B gamma| 2) Length = 418 Score = 55.1 bits (131), Expect = 6e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 93 TKVXLSDEAQKKRVEAMIEDLEPFEGQSLLD 1 TKV +SDEAQK+RV AMIEDLEPFEG+SLLD Sbjct: 383 TKVDISDEAQKERVSAMIEDLEPFEGESLLD 413
>EF1G1_ORYSA (Q9ZRI7) Elongation factor 1-gamma 1 (EF-1-gamma 1) (eEF-1B gamma| 1) Length = 418 Score = 53.9 bits (128), Expect = 1e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 93 TKVXLSDEAQKKRVEAMIEDLEPFEGQSLLD 1 TKV +SDEAQK+RV AMIEDLEPFEG++LLD Sbjct: 383 TKVDISDEAQKERVSAMIEDLEPFEGEALLD 413
>EF1G3_ORYSA (Q5Z627) Elongation factor 1-gamma 3 (EF-1-gamma 3) (eEF-1B gamma| 3) Length = 416 Score = 52.0 bits (123), Expect = 5e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 93 TKVXLSDEAQKKRVEAMIEDLEPFEGQSLLD 1 TKV LSDEAQK+RV AMIED EPFEG+ LLD Sbjct: 381 TKVDLSDEAQKERVNAMIEDQEPFEGEDLLD 411
>EF1G1_ARATH (O04487) Probable elongation factor 1-gamma 1 (EF-1-gamma 1)| (eEF-1B gamma 1) Length = 414 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 93 TKVXLSDEAQKKRVEAMIEDLEPFEGQSLLD 1 TKV +SDEAQK+RV MIED EPFEG++LLD Sbjct: 379 TKVDISDEAQKERVSQMIEDAEPFEGEALLD 409
>EF1G2_ARATH (Q9FVT2) Probable elongation factor 1-gamma 2 (EF-1-gamma 2)| (eEF-1B gamma 2) Length = 413 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 93 TKVXLSDEAQKKRVEAMIEDLEPFEGQSLLD 1 TKV +SDEAQK+RV MIED EPFEG++LLD Sbjct: 378 TKVDISDEAQKERVSQMIEDAEPFEGEALLD 408
>EF1G_PRUAV (Q9FUM1) Elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma)| Length = 422 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 93 TKVXLSDEAQKKRVEAMIEDLEPFEGQSLLD 1 TKV LSDE QK+RV +IED EPFEG++LLD Sbjct: 387 TKVDLSDENQKERVNQVIEDQEPFEGEALLD 417 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,961,607 Number of Sequences: 219361 Number of extensions: 103579 Number of successful extensions: 419 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 80,573,946 effective HSP length: 10 effective length of database: 78,380,336 effective search space used: 1881128064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)