| Clone Name | rbasd24f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SWA_DROME (P40688) Protein swallow | 29 | 8.9 |
|---|
>SWA_DROME (P40688) Protein swallow| Length = 548 Score = 28.9 bits (63), Expect = 8.9 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -1 Query: 266 NGSDVHFILEFAPDSHL*AHNHC*HARPVXGVWFFFFLFIGPCFSCRS 123 N S ++ SHL AH+H R G FL GPC CR+ Sbjct: 473 NDSQTRLLVHSMSMSHLEAHDHFRSKRTTLGSRMLRFL--GPCVRCRN 518 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,040,345 Number of Sequences: 219361 Number of extensions: 1228517 Number of successful extensions: 2483 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2467 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)