| Clone Name | rbasd24e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GNPI_CAEEL (Q9XVJ2) Probable glucosamine-6-phosphate isomerase (... | 28 | 4.4 | 2 | EVGS_ECOLI (P30855) Sensor protein evgS precursor (EC 2.7.13.3) | 27 | 9.8 | 3 | EVGS_ECO57 (P58402) Sensor protein evgS precursor (EC 2.7.13.3) | 27 | 9.8 |
|---|
>GNPI_CAEEL (Q9XVJ2) Probable glucosamine-6-phosphate isomerase (EC 3.5.99.6)| (Glucosamine-6-phosphate deaminase) (GNPDA) (GlcN6P deaminase) Length = 267 Score = 28.5 bits (62), Expect = 4.4 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 145 NFFRWELENPVLGIQILNGAINTLXTEHQCEKYEHK 252 NFFR NP I IL+G NT E +CE+YE K Sbjct: 91 NFFRHIDINPA-NIHILDG--NTSDHEKECEEYERK 123
>EVGS_ECOLI (P30855) Sensor protein evgS precursor (EC 2.7.13.3)| Length = 1197 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 112 VSKFQNSPGSQNFFRWELENPVLGIQILNGAINTLXTEHQCE 237 V K+ NSP NFF E+ +L ++LN ++ L E + E Sbjct: 230 VVKYYNSPRQYNFFLTRKESVILN-EVLNRFVDALTNEVRYE 270
>EVGS_ECO57 (P58402) Sensor protein evgS precursor (EC 2.7.13.3)| Length = 1197 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 112 VSKFQNSPGSQNFFRWELENPVLGIQILNGAINTLXTEHQCE 237 V K+ NSP NFF E+ +L ++LN ++ L E + E Sbjct: 230 VVKYYNSPRQYNFFLTRKESVILN-EVLNRFVDALTNEVRYE 270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,516,769 Number of Sequences: 219361 Number of extensions: 587456 Number of successful extensions: 1185 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1185 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)