| Clone Name | rbasd23p02 |
|---|---|
| Clone Library Name | barley_pub |
>ITA5_HUMAN (P08648) Integrin alpha-5 precursor (Fibronectin receptor alpha| subunit) (Integrin alpha-F) (VLA-5) (CD49e antigen) [Contains: Integrin alpha-5 heavy chain; Integrin alpha-5 light chain] Length = 1049 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/56 (35%), Positives = 24/56 (42%) Frame = +1 Query: 1 GILYLTTCVGFGYRYPFVEGRSSFSWEYGIGYILQRRSAWYEPRGEAIASPRGSYF 168 G YL+T F + RS FSW G GY SA + G + GSYF Sbjct: 174 GTCYLSTD-NFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYF 228
>SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein| Length = 977 Score = 29.6 bits (65), Expect = 1.9 Identities = 21/67 (31%), Positives = 28/67 (41%) Frame = -1 Query: 224 EGVEKMPRAEXXVPSAXXLKYEPRGLAIASPRGSYQALRR*SM*PMPYSQEKLERPSTKG 45 EG++ PRA+ P A L P +ASPR + P P + RP T G Sbjct: 417 EGLQSPPRAQSAPPEAAVLPPSPLPAPVASPRPFQPGGGAPT--PAPSIFNRSARPFTPG 474 Query: 44 YLYPKPT 24 +PT Sbjct: 475 LQGQRPT 481
>CP74A_ARATH (Q96242) Cytochrome P450 74A, chloroplast precursor (EC 4.2.1.92)| (Allene oxide synthase) (Hydroperoxide dehydrase) Length = 518 Score = 28.9 bits (63), Expect = 3.2 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +2 Query: 32 SGTGTLLLKVVRAFPGSMASVTYFSAVAPGMSLVEKQLL--VHGAHTSXXXRLVLXPRLE 205 S GT + RAF G+ + T A APG L+ K +L +H + R++ P + Sbjct: 212 SSDGTAFNFLARAFYGTNPADTKLKADAPG--LITKWVLFNLHPLLSIGLPRVIEEPLIH 269 Query: 206 AFSLPLLTLK 235 FSLP +K Sbjct: 270 TFSLPPALVK 279
>YBIC_ECOLI (P30178) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 105 LKYVTDAILPGKARTTFNKRVPVP 34 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202
>YBIC_ECO57 (P58409) Hypothetical oxidoreductase ybiC (EC 1.1.1.-)| Length = 361 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 105 LKYVTDAILPGKARTTFNKRVPVP 34 L Y T AI GK R ++K VPVP Sbjct: 179 LDYATSAIAFGKTRVAWHKGVPVP 202
>DMBT1_PIG (Q4A3R3) Deleted in malignant brain tumors 1 protein precursor| Length = 1204 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 94 YILQRRSAWYEPRGEAIASPRGSYFXXXALGTXXSARGIFSTPSYP 231 Y W+ P ASP G SA G FS+PSYP Sbjct: 494 YTTTPSQTWWHPTTTTAASPSSP-----CGGFLTSASGTFSSPSYP 534 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,274,958 Number of Sequences: 219361 Number of extensions: 739560 Number of successful extensions: 1840 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1829 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)