| Clone Name | rbasd24e07 |
|---|---|
| Clone Library Name | barley_pub |
>ACT3_PODCA (P41113) Actin-3| Length = 376 Score = 29.3 bits (64), Expect = 3.2 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 SS PPT K+ PP + SVW S LAS Sbjct: 319 SSLAPPTMKIKIIAPPERKYSVWIGGSILAS 349
>ACT1_PODCA (P41112) Actin-1/2| Length = 376 Score = 29.3 bits (64), Expect = 3.2 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 SS PPT K+ PP + SVW S LAS Sbjct: 319 SSLAPPTMKIKIIAPPERKYSVWIGGSILAS 349
>WASL_HUMAN (O00401) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 29.3 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 112 KSSSPPPTTKLTAACPPPXRPSVWSIASP 26 + + PPP ++ A PPP PS S+A P Sbjct: 307 RGAPPPPPSRAPTAAPPPPPPSRPSVAVP 335
>PCLO_MOUSE (Q9QYX7) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) (Brain-derived HLMN protein) Length = 5038 Score = 29.3 bits (64), Expect = 3.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 112 KSSSPPPTTKLTAACPPPXRPSVWSIASPLASSH 11 + S+ P TK+ AA PPP P SI + L +H Sbjct: 2371 RRSNGLPATKICAAAPPPVPPKPSSIPTGLVFTH 2404
>FL1_TOBAC (Q40504) Floricaula/leafy homolog 1 (NFL1)| Length = 413 Score = 28.9 bits (63), Expect = 4.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 112 KSSSPPPTTKLTAACPPPXRPSVWSIASPLASSH 11 + + PPPT L AA PP P V PL++++ Sbjct: 16 RGAMPPPTRLLEAAVAPPPPPPVLPPPQPLSAAY 49
>ACT2_ECHGR (Q03341) Actin-2| Length = 376 Score = 28.5 bits (62), Expect = 5.5 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 SS P T K+ A PP + SVW S LAS Sbjct: 319 SSLAPTTVKIRIAAPPERKYSVWIGGSILAS 349
>ACT_HYDAT (P17126) Actin, non-muscle 6.2| Length = 376 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 S+ PPT K+ PP + SVW S LAS Sbjct: 319 SALAPPTMKIKIIAPPERKYSVWIGGSILAS 349
>ACTE_STRPU (P53474) Actin, cytoskeletal IIIA| Length = 376 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 S+ PPT K+ PP + SVW S LAS Sbjct: 319 SALAPPTMKIKIIAPPERKYSVWIGGSILAS 349
>ACT2_LYTPI (P53466) Actin, cytoskeletal 2 (LPC2)| Length = 376 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 S+ PPT K+ PP + SVW S LAS Sbjct: 319 SALAPPTMKIKIIAPPERKYSVWIGGSILAS 349
>ACT4_LYTPI (Q25380) Actin, cytoskeletal 4 (LPC4) (Fragment)| Length = 154 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 +S PPT K+ PP + SVW S LAS Sbjct: 105 TSLAPPTMKIKIIAPPERKYSVWIGGSILAS 135
>ACTC_STYPL (Q00215) Actin, cytoplasmic| Length = 375 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPPXRPSVWSIASPLAS 17 S+ PPT K+ PP + SVW S LAS Sbjct: 318 SALAPPTMKIKIIAPPERKYSVWIGGSILAS 348
>MMPS3_MYCTU (P65378) Putative membrane protein mmpS3| Length = 299 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPP 59 +++PPP T TAA PPP Sbjct: 187 TTAPPPATTTTAAAPPP 203
>MMPS3_MYCBO (P65379) Putative membrane protein mmpS3| Length = 299 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 109 SSSPPPTTKLTAACPPP 59 +++PPP T TAA PPP Sbjct: 187 TTAPPPATTTTAAAPPP 203
>MAST3_HUMAN (O60307) Microtubule-associated serine/threonine-protein kinase 3 (EC| 2.7.11.1) Length = 1309 Score = 27.7 bits (60), Expect = 9.3 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 10/43 (23%) Frame = -1 Query: 109 SSSPPPTTKL----------TAACPPPXRPSVWSIASPLASSH 11 S SP PTT T A PP PS S ASP A+ H Sbjct: 1113 SLSPSPTTPCRSPAPDVPADTTASPPSASPSSSSPASPAAAGH 1155
>ACT_ENTHI (P11426) Actin| Length = 376 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 97 PPTTKLTAACPPPXRPSVWSIASPLAS 17 PPT K+ PP + SVW S LAS Sbjct: 323 PPTMKIKVIAPPERKYSVWIGGSILAS 349
>ACT_CRAVI (Q92193) Actin (Fragment)| Length = 266 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 97 PPTTKLTAACPPPXRPSVWSIASPLAS 17 PPT K+ PP + SVW S LAS Sbjct: 239 PPTMKIKVIAPPERKYSVWIGGSILAS 265
>ACT_CRAGI (O17320) Actin| Length = 376 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 97 PPTTKLTAACPPPXRPSVWSIASPLAS 17 PPT K+ PP + SVW S LAS Sbjct: 323 PPTMKIKVIAPPERKYSVWIGGSILAS 349
>PKN3_MOUSE (Q8K045) Serine/threonine-protein kinase N3 (EC 2.7.11.13) (Protein| kinase PKN-beta) (Protein-kinase C-related kinase 3) Length = 878 Score = 27.7 bits (60), Expect = 9.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 121 GEMKSSSPPPTTKLTAACPPPXRPSVWSIASPLASSHXSF 2 G + S PP + A PP RPS +P A+S +F Sbjct: 448 GRLVMSLLPPCSSPNTASPPKGRPSTAVCGTPSAASPSNF 487
>P53_CHICK (P10360) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 367 Score = 27.7 bits (60), Expect = 9.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 100 PPPTTKLTAACPPPXRPSVWSIASP 26 PPP L AA PPP P A+P Sbjct: 54 PPPPLPLAAAAPPPLNPPTPPRAAP 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,955,156 Number of Sequences: 219361 Number of extensions: 165448 Number of successful extensions: 1604 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1575 length of database: 80,573,946 effective HSP length: 15 effective length of database: 77,283,531 effective search space used: 1854804744 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)