| Clone Name | rbasd24d17 |
|---|---|
| Clone Library Name | barley_pub |
>PPA1_ASPNG (P20584) Phosphate-repressible acid phosphatase precursor (EC| 3.1.3.2) (Acid phosphatase PII) Length = 436 Score = 31.2 bits (69), Expect = 1.1 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = -3 Query: 300 AVVWVRALGGSYQPFSTPHHHPVTLVXXGFL*TXCGLKSFVLEHHQPGVLPKPSPRSPLL 121 ++ W+ G PF HHP+TL T G S P +LP P + LL Sbjct: 364 SMAWMLTSLGDVCPFFKLVHHPLTLSSA----TSTGTSSLSSRATAPSILP-PCEQQHLL 418 Query: 120 CP 115 CP Sbjct: 419 CP 420
>CRUP_STRCO (Q9ACU1) Bifunctional crtB/uppS protein [Includes: Phytoene| synthase (EC 2.5.1.-); Undecaprenyl pyrophosphate synthetase 3 (EC 2.5.1.31) (UPP synthetase 3) (Di-trans,poly-cis-decaprenylcistransferase 3) (Undecaprenyl diphosphate synthase 3) (U Length = 564 Score = 30.0 bits (66), Expect = 2.4 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Frame = +1 Query: 130 APGRRLWKDARLVML*NK*FQAAXSSQEAXXDQGHRMMMRR*ERLIGTTQRSNPYH---- 297 A G R W +AR ++ DQGHR +R RL+ QR+ H Sbjct: 328 ADGNRRWAEARGLL----------------ADQGHRAGIRAVLRLVNAAQRTGIRHVTVY 371 Query: 298 SFSWKKWY 321 FS + WY Sbjct: 372 MFSTENWY 379
>GAIPB_CUCMA (Q6EI05) DELLA protein GAIP-B (Gibberellic acid-insensitive phloem| protein B) (GAIP-B) (CmGAIP-B) Length = 587 Score = 29.3 bits (64), Expect = 4.0 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -3 Query: 303 EAVVWVRALGGSYQPFSTPHHHPVTLVXXGFL*TXCGLKSFVLEHHQPGVLPKPSP 136 EA+ V+ G S+ F T H++P L L+S + E H P P+P P Sbjct: 73 EAMCQVQDTGLSHLAFDTVHYNPSDL--------STWLESMITELHPPPSFPQPHP 120
>TRMU_SYNEL (Q8CWM0) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 369 Score = 28.5 bits (62), Expect = 6.9 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -3 Query: 327 PTIPFFPAEAVVWV---RALGGSY-QPFSTPHHHPV 232 P P +A VW R LGG QPF TP HP+ Sbjct: 327 PQFGVTPGQAAVWYAGDRLLGGGIIQPFGTPTLHPL 362
>NCOR1_HUMAN (O75376) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR)| Length = 2440 Score = 28.5 bits (62), Expect = 6.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 193 LEIICSRASPAGRPSKAFSQEPPVVSSHKLENAPT 89 +E+I +SPA K + +P VV +++ EN PT Sbjct: 1973 IEVISPASSPAPPQEKLQTYQPEVVKANQAENDPT 2007
>YEHM_ECOLI (P33349) Hypothetical protein yehM| Length = 759 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 180 VLEHHQPGVLPKPSPRSPLLCPLTSLRMHLLLRSHAV 70 VLEH+Q LP + + PL CP ++ H L A+ Sbjct: 712 VLEHYQLAQLPVSALQMPLHCPPQAIAHHQQLEQQAL 748 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,334,406 Number of Sequences: 219361 Number of extensions: 1019558 Number of successful extensions: 2439 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2439 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)