| Clone Name | rbasd24c12 |
|---|---|
| Clone Library Name | barley_pub |
>TNAP3_MACFA (Q4R8W3) Tumor necrosis factor, alpha-induced protein 3 (EC| 3.-.-.-) Length = 790 Score = 32.3 bits (72), Expect = 0.88 Identities = 18/65 (27%), Positives = 26/65 (40%), Gaps = 2/65 (3%) Frame = -1 Query: 327 SSPSCAKTTSSRKLSGRHTRFMCRPASRPS--CGEGGHRGQLPTVMTPSRPSWPEKC*NF 154 S P CA+ + L+ R +C P+ G G HRG+ P + W C +F Sbjct: 712 SRPKCARASCKNILACRSEE-LCMECQHPNPRMGPGAHRGEPAPEDPPKQRCWAPACDHF 770 Query: 153 AERSC 139 C Sbjct: 771 GNAKC 775
>GP156_HUMAN (Q8NFN8) Probable G-protein coupled receptor 156 (GABAB-related| G-protein coupled receptor) (G-protein coupled receptor PGR28) Length = 814 Score = 30.4 bits (67), Expect = 3.3 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -1 Query: 360 SKKRKTHFPAISSPSCAKTTSSRKLSGRHTRFMCRPASRPSCG--EGGHRGQLPTVMTPS 187 +++ ++HFP S+PS ++R + G H+R + PS R + P+ PS Sbjct: 605 AQRARSHFPG-SAPSSVGHRANRTVPGAHSRLHVQNGDSPSLAPQTTDSRVRRPSSRKPS 663 Query: 186 RPSWPE 169 PS P+ Sbjct: 664 LPSDPQ 669
>RNH_SYNEL (Q8DM24) Ribonuclease H (EC 3.1.26.4) (RNase H)| Length = 159 Score = 30.0 bits (66), Expect = 4.4 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 448 LSPDLYASLTAPLPPKIYWH-IQGNGGDVGKQKEEDSLPCDFI 323 L+ DL+ L A P + WH ++G+ GDVG ++ CD I Sbjct: 103 LNQDLWQELDALNDPLVQWHHVRGHRGDVGNER------CDLI 139
>LYAM2_BOVIN (P98107) E-selectin precursor (Endothelial leukocyte adhesion| molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD62E antigen) Length = 485 Score = 29.6 bits (65), Expect = 5.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +1 Query: 61 QFLQSTSNRTTSH----LGSTQPVWSWYGTTRSLCKILTFFRPGWP 186 ++L ST + + S+ + W+W GT +SL K T + PG P Sbjct: 58 EYLNSTFSYSPSYYWIGIRKINGTWTWIGTNKSLTKEATNWAPGEP 103
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 29.3 bits (64), Expect = 7.5 Identities = 20/70 (28%), Positives = 28/70 (40%) Frame = -1 Query: 336 PAISSPSCAKTTSSRKLSGRHTRFMCRPASRPSCGEGGHRGQLPTVMTPSRPSWPEKC*N 157 PA + SC + +SS L +CRP RP+C PT + P C + Sbjct: 295 PACCTTSCCRPSSSVSL-------LCRPVCRPACCVPVPSCCAPTSSCQASCCRPASCVS 347 Query: 156 FAERSCCTIP 127 R C+ P Sbjct: 348 LLCRPACSRP 357
>TRMB_MYCTU (P67498) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 263 Score = 29.3 bits (64), Expect = 7.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 145 SLCKILTFFRPGWP*GRHYRR*LAPVSTLS 234 SLC + FF WP RH++R L +T++ Sbjct: 149 SLCGVRVFFPDPWPKARHHKRRLLQPATMA 178
>TRMB_MYCBO (P67499) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 263 Score = 29.3 bits (64), Expect = 7.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 145 SLCKILTFFRPGWP*GRHYRR*LAPVSTLS 234 SLC + FF WP RH++R L +T++ Sbjct: 149 SLCGVRVFFPDPWPKARHHKRRLLQPATMA 178
>DNJH_ATRNU (P43644) DnaJ protein homolog ANJ1| Length = 417 Score = 29.3 bits (64), Expect = 7.5 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 496 LAGIIVLHSTRELDQNLSPDLYASLTAPLPPK 401 + G + +H T E +L+PD SL A LPPK Sbjct: 330 MKGKMYIHFTVEFPDSLNPDQVKSLEAILPPK 361
>SEO1_YEAST (P39709) Probable transporter SEO1| Length = 593 Score = 28.9 bits (63), Expect = 9.7 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 10/44 (22%) Frame = +2 Query: 416 CSERCIKVWRQILIKFSSGMEHNNTGKN----------CEKPTS 517 CS C+ +W +++ F E NN KN EKPTS Sbjct: 538 CSAFCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTS 581
>SRE29_CAEEL (O62269) Serpentine receptor class epsilon-29 (Protein sre-29)| Length = 356 Score = 28.9 bits (63), Expect = 9.7 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 347 FLFLLPYIAAVSLYVPVYLWRQGCSE-----RCIKVWRQILIKFSSGMEHNNTGKNCEKP 511 FLFL PY++ ++ V W+ E RC+K+ R + I+ + ME ++ K Sbjct: 285 FLFLHPYLSCLTAIFSVPQWKNEFREVSVLGRCLKIGR-LKIESENAMEIQDSTKKMGTE 343 Query: 512 TSL 520 T L Sbjct: 344 TDL 346
>Y649_ARCFU (O29608) UPF0280 protein AF0649| Length = 233 Score = 28.9 bits (63), Expect = 9.7 Identities = 25/72 (34%), Positives = 32/72 (44%) Frame = -3 Query: 490 GIIVLHSTRELDQNLSPDLYASLTAPLPPKIYWHIQGNGGDVGKQKEEDSLPCDFITVVR 311 G IV+HS REL + P + L +PP Y I + G +G D TVV Sbjct: 106 GDIVIHSDRELLVGIYP---SKLAFKVPPVDYLAICTSSGKIGHSVSFGK--ADAATVVA 160 Query: 310 QDYFV*KTLRTA 275 +D V L TA Sbjct: 161 RDASVADALATA 172 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,060,761 Number of Sequences: 219361 Number of extensions: 1854277 Number of successful extensions: 4709 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4707 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)