| Clone Name | rbasd23j13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATC3_YEAST (P39524) Probable phospholipid-transporting ATPase DR... | 30 | 1.2 | 2 | COG2_MOUSE (Q921L5) Conserved oligomeric Golgi complex component... | 28 | 8.0 |
|---|
>ATC3_YEAST (P39524) Probable phospholipid-transporting ATPase DRS2 (EC 3.6.3.1)| Length = 1355 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 62 FRLSIIIMGTIMHYLYSSSLEFIPHIKL*RHWDWNAT 172 F +I+ +GTI+ Y Y +L H +L HW W T Sbjct: 1103 FHSAIVFIGTILIYRYGFALNM--HGELADHWSWGVT 1137
>COG2_MOUSE (Q921L5) Conserved oligomeric Golgi complex component 2 (Low| density lipoprotein receptor defect C-complementing protein) Length = 731 Score = 27.7 bits (60), Expect = 8.0 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Frame = +2 Query: 95 MHYLYSSSLEFIP-HIKL*RHWDWNATEA----IIEGNDX*LNLQWPXVXRLXXXKL 250 + +Y+ LEF+P H +L R A + I+ G D +N WP + R KL Sbjct: 272 LQLMYNKLLEFVPHHCRLLREVTGGAVSSEKGTIVPGYDFLVNSVWPEIVRGLEEKL 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,711,173 Number of Sequences: 219361 Number of extensions: 549510 Number of successful extensions: 990 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)