| Clone Name | rbasd23j02 |
|---|---|
| Clone Library Name | barley_pub |
>UBL5_ARATH (Q9FGZ9) Ubiquitin-like protein 5| Length = 73 Score = 67.8 bits (164), Expect = 6e-12 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 329 RIQKWYTIYKDHITLGDYEIHDGMGLELYYN 237 RIQKWY IYKDHITL DYEIHDGMGLELYYN Sbjct: 43 RIQKWYNIYKDHITLKDYEIHDGMGLELYYN 73
>UBL5_PSAOB (Q791B0) Ubiquitin-like protein 5 (Beacon protein)| Length = 73 Score = 60.5 bits (145), Expect = 1e-09 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTI+KDH++LGDYEIHDGM LELYY Sbjct: 44 LKKWYTIFKDHVSLGDYEIHDGMNLELYY 72
>UBL5_MOUSE (Q9EPV8) Ubiquitin-like protein 5| Length = 73 Score = 60.5 bits (145), Expect = 1e-09 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTI+KDH++LGDYEIHDGM LELYY Sbjct: 44 LKKWYTIFKDHVSLGDYEIHDGMNLELYY 72
>UBL5_MESAU (Q6EGX7) Ubiquitin-like protein 5 (Beacon protein)| Length = 73 Score = 60.5 bits (145), Expect = 1e-09 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTI+KDH++LGDYEIHDGM LELYY Sbjct: 44 LKKWYTIFKDHVSLGDYEIHDGMNLELYY 72
>UBL5_HUMAN (Q9BZL1) Ubiquitin-like protein 5| Length = 73 Score = 60.5 bits (145), Expect = 1e-09 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTI+KDH++LGDYEIHDGM LELYY Sbjct: 44 LKKWYTIFKDHVSLGDYEIHDGMNLELYY 72
>UBL5_BRARE (Q7SXF2) Ubiquitin-like protein 5| Length = 73 Score = 58.5 bits (140), Expect = 4e-09 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTI+K+H++LGDYEIHDGM LELYY Sbjct: 44 LKKWYTIFKNHVSLGDYEIHDGMNLELYY 72
>UBL5_CAEEL (P91302) Ubiquitin-like protein 5| Length = 73 Score = 55.5 bits (132), Expect = 3e-08 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTIYKDHITL DYEIH+G ELYY Sbjct: 44 LKKWYTIYKDHITLMDYEIHEGFNFELYY 72
>UBL5_DROME (Q9V998) Ubiquitin-like protein 5| Length = 73 Score = 53.9 bits (128), Expect = 1e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 ++KWYTI+KD I L DYEIHDGM LELYY Sbjct: 44 LKKWYTIFKDPIRLSDYEIHDGMNLELYY 72
>HUB1_SCHPO (O94650) Ubiquitin-like modifier hub1| Length = 73 Score = 53.1 bits (126), Expect = 2e-07 Identities = 19/30 (63%), Positives = 28/30 (93%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYYN 237 ++KW++++KD+ITL DYEIHDGM LE+YY+ Sbjct: 44 LKKWHSVFKDNITLADYEIHDGMSLEMYYS 73
>HUB1_DEBHA (Q6BUP7) Ubiquitin-like modifier HUB1| Length = 73 Score = 48.1 bits (113), Expect = 5e-06 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYYN 237 ++K Y +YKDHITL DYE+H+G ELYY+ Sbjct: 44 LKKGYQVYKDHITLDDYEVHNGFNFELYYS 73
>HUB1_KLULA (Q6CU12) Ubiquitin-like modifier HUB1| Length = 74 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 +QK ++ KDHITL DYE+HDG LELYY Sbjct: 45 LQKGGSVLKDHITLEDYEVHDGTNLELYY 73
>HUB1_CANGA (Q6FIX7) Ubiquitin-like modifier HUB1| Length = 73 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYYN 237 +QK ++ KDHITL DYE+HD LELYY+ Sbjct: 44 LQKGGSVLKDHITLYDYEVHDNTNLELYYS 73
>HUB1_YEAST (Q6Q546) Ubiquitin-like modifier HUB1| Length = 73 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = -3 Query: 326 IQKWYTIYKDHITLGDYEIHDGMGLELYY 240 +QK ++ KDHI+L DYE+HD LELYY Sbjct: 44 LQKGGSVLKDHISLEDYEVHDQTNLELYY 72
>HUB1_ASHGO (Q756X3) Ubiquitin-like modifier HUB1| Length = 73 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -3 Query: 302 KDHITLGDYEIHDGMGLELYY 240 KDHI+L DYE+HDG LELYY Sbjct: 52 KDHISLDDYEVHDGTYLELYY 72
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 34.7 bits (78), Expect = 0.061 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 203 TKPAXAGGDEASCSRARGPSHRGSRSRQG*CGPCRWC 313 ++P +GG A R PSH G + R CG CR C Sbjct: 936 SEPTGSGGTLAHTPRRSLPSHHGKKMRMARCGHCRGC 972
>ATC3_YEAST (P39524) Probable phospholipid-transporting ATPase DRS2 (EC 3.6.3.1)| Length = 1355 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 63 FRLSIIIMGTIMHYLYSSSLEFIPHIKL*RHWDWNAT 173 F +I+ +GTI+ Y Y +L H +L HW W T Sbjct: 1103 FHSAIVFIGTILIYRYGFALNM--HGELADHWSWGVT 1137
>TBX15_MOUSE (O70306) T-box transcription factor TBX15 (T-box protein 15)| (MmTBx8) Length = 602 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -1 Query: 253 SSSTTTSLITPGXXRFSHLSLPSM------IASVAFQSQCLQSLMCGMNSSE 116 +S TT+S TP SHL PS +A F C +S +C +N S+ Sbjct: 347 TSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSD 398
>TBX15_HUMAN (Q96SF7) T-box transcription factor TBX15 (T-box protein 15)| Length = 602 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -1 Query: 253 SSSTTTSLITPGXXRFSHLSLPSM------IASVAFQSQCLQSLMCGMNSSE 116 +S TT+S TP SHL PS +A F C +S +C +N S+ Sbjct: 347 TSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSD 398
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 167 RNRSYHRRQ**-VTKPAXAGGDEASCSRARGPSHRGSR 277 R+R HRR +PA G DE RGP HR R Sbjct: 179 RSRGTHRRHLRQAPRPAVRGPDEDQAREFRGPRHRRER 216
>ERG3_NEUCR (Q7SBB6) Probable C-5 sterol desaturase (EC 1.3.3.-)| (Sterol-C5-desaturase) (Ergosterol delta 5,6 desaturase) Length = 344 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 327 HPEVVHHLQGPHHPWRLRDP 268 HP V HL PHH W + P Sbjct: 186 HPLVYKHLHKPHHKWIMPTP 205
>ARFJ_ARATH (Q9SKN5) Auxin response factor 10| Length = 693 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 321 EVVHHLQGPHHPWRLRDPRWDGPRALLQLASSPPAXAGLVT 199 +V ++ P+ PWRL WD P L + P LV+ Sbjct: 344 QVADPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVS 384
>EXTN3_ARATH (Q9FS16) Extensin-3 precursor (AtExt3) (AtExt5)| Length = 427 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 324 PEVVHHLQGPHHPWRLRDP 268 P VHH PHHP+ + P Sbjct: 403 PPPVHHYSPPHHPYLYKSP 421
>ERG3_LEPMC (Q8J207) C-5 sterol desaturase (EC 1.3.3.-) (Sterol-C5-desaturase)| (Ergosterol delta 5,6 desaturase) Length = 356 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 327 HPEVVHHLQGPHHPWRLRDP 268 HP V H+ PHH W + P Sbjct: 197 HPMVYKHIHKPHHKWIMPTP 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,552,891 Number of Sequences: 219361 Number of extensions: 819362 Number of successful extensions: 2139 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2139 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)