| Clone Name | rbasd22p19 |
|---|---|
| Clone Library Name | barley_pub |
>DYHC_DROME (P37276) Dynein heavy chain, cytosolic (DYHC)| Length = 4639 Score = 29.3 bits (64), Expect = 4.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 147 RIFSTNECSPPVPLSRIQNGRFFIHKP 227 R+F T E +P VP++ ++ GR F+ +P Sbjct: 4107 RLFLTMEINPKVPVNLLRAGRIFVFEP 4133
>DYHC_HUMAN (Q14204) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein| heavy chain 1) (DHC1) (Dynein heavy chain 1, cytoplasmic 1) Length = 4646 Score = 29.3 bits (64), Expect = 4.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 147 RIFSTNECSPPVPLSRIQNGRFFIHKP 227 R+F T E +P VP++ ++ GR F+ +P Sbjct: 4123 RLFLTMEINPKVPVNLLRAGRIFVFEP 4149
>LRP11_HUMAN (Q86VZ4) Low-density lipoprotein receptor-related protein 11| precursor Length = 500 Score = 29.3 bits (64), Expect = 4.8 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 341 PRACFGWSGC-ACSCLVPRAALSSVGLP*LRASPRAVL 451 P A GW C A C PR +++ V LP A P AVL Sbjct: 121 PAAVRGWRQCVAACCSEPRCSVAVVELPRRPAPPAAVL 158
>RP1_MOUSE (P56716) Oxygen-regulated protein 1 (Retinitis pigmentosa RP1 protein| homolog) Length = 2095 Score = 29.3 bits (64), Expect = 4.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 410 LSSTLLEEPSKNKHIQTIRSMPEVGLFY 327 LS T + EPS H+ +S PEV L Y Sbjct: 1011 LSQTTINEPSTKSHLSIEKSRPEVKLVY 1038
>DYHC_MOUSE (Q9JHU4) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein| heavy chain 1) (DHC1) (Dynein heavy chain 1, cytoplasmic 1) Length = 4644 Score = 29.3 bits (64), Expect = 4.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 147 RIFSTNECSPPVPLSRIQNGRFFIHKP 227 R+F T E +P VP++ ++ GR F+ +P Sbjct: 4121 RLFLTMEINPKVPVNLLRAGRIFVFEP 4147
>UL27_HCMVA (P16763) Hypothetical protein UL27| Length = 608 Score = 28.9 bits (63), Expect = 6.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 417 SPTELNAARGTKQEQAHPDHPKHA 346 +P +L AA G K++ P HPKHA Sbjct: 78 TPEDLAAAGGQKKKTPAPKHPKHA 101
>DYHC_RAT (P38650) Dynein heavy chain, cytosolic (DYHC) (Cytoplasmic dynein| heavy chain 1) (DHC1) (Dynein heavy chain 1, cytoplasmic 1) (MAP 1C) Length = 4644 Score = 28.9 bits (63), Expect = 6.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 147 RIFSTNECSPPVPLSRIQNGRFFIHKP 227 R+F T E +P VP++ ++ GR F+ +P Sbjct: 4121 RLFLTMEINPRVPVNLLRAGRIFVFEP 4147
>SUVH5_ARATH (O82175) Histone-lysine N-methyltransferase, H3 lysine-9 specific| SUVH5 (EC 2.1.1.43) (Histone H3-K9 methyltransferase 5) (H3-K9-HMTase 5) (Suppressor of variegation 3-9 homolog protein 5) (Su(var)3-9 homolog protein 5) (Protein SET DOMAIN GR Length = 794 Score = 28.5 bits (62), Expect = 8.2 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +2 Query: 293 MFVAACLRRGMCRRVPPRACFGWSGCA----CSCLV 388 ++ A + CR +PP++C +GC+ C+C+V Sbjct: 568 IYTAKMIYPDWCRPIPPKSCGCTNGCSKSKNCACIV 603
>PCQAP_HUMAN (Q96RN5) Positive cofactor 2 glutamine/Q-rich-associated protein| (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) Length = 788 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -1 Query: 452 AGLPLAKL-LARVAQLSSTLLEEPSKNKHIQTIRSMP 345 + +PL + +A+V+Q S +L PS + +QT +SMP Sbjct: 413 SSIPLGRQPMAQVSQSSLPMLSSPSPGQQVQTPQSMP 449 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,254,694 Number of Sequences: 219361 Number of extensions: 1414921 Number of successful extensions: 4154 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4154 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)