| Clone Name | rbasd23e23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INVO_TARBA (P24711) Involucrin | 32 | 2.8 | 2 | PRP5_HUMAN (P04281) Basic proline-rich peptide IB-1 | 30 | 8.0 |
|---|
>INVO_TARBA (P24711) Involucrin| Length = 387 Score = 31.6 bits (70), Expect = 2.8 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = -3 Query: 731 KRINXQQIQKQVWDSRAPNLVAGEKQQEP-KVTVPNGVNGEK--QQDAINGKPKSPVANG 561 K++ Q+ + Q D + P L G KQQEP + V G +K +Q+A GK + P Sbjct: 61 KQVPEQECEPQQQDHQEPELQLGRKQQEPQEQEVHPGKQQQKPQEQEAHLGKKQEPQGQE 120 Query: 560 VNGG 549 V+ G Sbjct: 121 VHLG 124
>PRP5_HUMAN (P04281) Basic proline-rich peptide IB-1| Length = 96 Score = 30.0 bits (66), Expect = 8.0 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -3 Query: 716 QQIQKQVWDSRAPNLVAGEKQQEPKVTVPNGVNGEKQQDAINGKPKSPVANGVN 555 Q + + V +P+L+AG Q P P G N + + GKP+ P G N Sbjct: 1 QNLNEDVSQEESPSLIAGNPQGAP----PQGGNKPQGPPSPPGKPQGPPPQGGN 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,337,700 Number of Sequences: 219361 Number of extensions: 1460521 Number of successful extensions: 4066 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4065 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)