| Clone Name | rbasd23e17 |
|---|---|
| Clone Library Name | barley_pub |
>BXA2_CLOBO (Q45894) Botulinum neurotoxin type A precursor (EC 3.4.24.69)| (BoNT/A) (Bontoxilysin A) (BOTOX) [Contains: Botulinum neurotoxin A light-chain; Botulinum neurotoxin A heavy-chain] Length = 1295 Score = 30.8 bits (68), Expect = 4.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 701 DVWQLQESLAPKTADPQGLWQRCKQNYASCNSNQLQFL 588 DV L + + K+ D QG+ +CK N N N + F+ Sbjct: 1212 DVGNLSQVVVMKSKDDQGIRNKCKMNLQDNNGNDIGFI 1249
>ZP3_MOUSE (P10761) Zona pellucida sperm-binding protein 3 precursor (Zona| pellucida glycoprotein ZP3) (Sperm receptor) (Zona pellucida protein C) Length = 424 Score = 30.4 bits (67), Expect = 5.8 Identities = 19/75 (25%), Positives = 31/75 (41%) Frame = +2 Query: 482 CLSLWQWAKHELINTPFCPDAEKPFTALSISFLSHLETEVDCYYKTRNSACIFAIDLGDQ 661 C S Q K L+ + F +P + LSI + +E ++C Y + + I Q Sbjct: 98 CSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPI----Q 153 Query: 662 PFWEPNSLEAATRHK 706 P W P ++ K Sbjct: 154 PTWVPFRATVSSEEK 168
>MURC_PARUW (Q6MBS8) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 454 Score = 30.0 bits (66), Expect = 7.6 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -2 Query: 467 RATLLVLATRESQKRSVTGSSRGATPSTPTVRTLATAHAITLCSRGGI 324 RA LL L TR+ + +VTG+ T S+ TL A+ + + GGI Sbjct: 91 RAELLALLTRQKKSLAVTGTHGKTTTSSLLATTLLEANCDSSFAVGGI 138
>TYRP1_AMBME (P55027) 5,6-dihydroxyindole-2-carboxylic acid oxidase precursor| (EC 1.14.18.-) (DHICA oxidase) (Tyrosinase-related protein 1) (TRP-1) (TRP1) Length = 534 Score = 29.6 bits (65), Expect = 10.0 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -2 Query: 401 GATPSTPTVRTLATAHAITLCSRGGIFNTIISFDTSS*CAENPMSGYNQ-KGRY 243 G + P V+ L + LC G+F+T + SS N + GY++ G+Y Sbjct: 316 GGNVARPMVQRLPEPQDVALCLEVGLFDTPPFYSNSSESFRNTVEGYSEPSGKY 369
>CYSJ_BLOFL (Q7VQH2) Sulfite reductase [NADPH] flavoprotein alpha-component (EC| 1.8.1.2) (SIR-FP) Length = 610 Score = 29.6 bits (65), Expect = 10.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 244 IDRRRWVQVCGLPGVHHLRYDMIGQGLARKSGKAL 140 ++R++ L VHHL +D+ G GL + G AL Sbjct: 251 LNRQKITSCNSLKDVHHLEFDISGSGLCYQPGDAL 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111,285,003 Number of Sequences: 219361 Number of extensions: 2423479 Number of successful extensions: 6627 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6627 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7536258401 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)