| Clone Name | rbasd23d11 |
|---|---|
| Clone Library Name | barley_pub |
>SR542_HORVU (P49969) Signal recognition particle 54 kDa protein 2 (SRP54)| Length = 497 Score = 40.4 bits (93), Expect = 0.005 Identities = 20/29 (68%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = -3 Query: 652 SASRGLVS-SNATVVDERVLGDCLNEITR 569 S SR L SNATV+DE+VLG+CLNEI+R Sbjct: 9 SISRALAQMSNATVIDEKVLGECLNEISR 37
>SR541_HORVU (P49968) Signal recognition particle 54 kDa protein 1 (SRP54)| Length = 497 Score = 40.4 bits (93), Expect = 0.005 Identities = 20/29 (68%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = -3 Query: 652 SASRGLVS-SNATVVDERVLGDCLNEITR 569 S SR L SNATV+DE+VLG+CLNEI+R Sbjct: 9 SISRALAQMSNATVIDEKVLGECLNEISR 37
>SR542_LYCES (P49972) Signal recognition particle 54 kDa protein 2 (SRP54)| Length = 499 Score = 38.5 bits (88), Expect = 0.018 Identities = 19/29 (65%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -3 Query: 652 SASRGLVS-SNATVVDERVLGDCLNEITR 569 S SR L SNAT++DE+VL +CLNEITR Sbjct: 9 SISRALQQMSNATIIDEKVLNECLNEITR 37
>SR541_LYCES (P49971) Signal recognition particle 54 kDa protein 1 (SRP54)| Length = 496 Score = 38.5 bits (88), Expect = 0.018 Identities = 19/29 (65%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -3 Query: 652 SASRGLVS-SNATVVDERVLGDCLNEITR 569 S SR L SNAT++DE+VL +CLNEITR Sbjct: 9 SISRALQQMSNATIIDEKVLNECLNEITR 37
>SR543_HORVU (P49970) Signal recognition particle 54 kDa protein 3 (SRP54)| Length = 493 Score = 36.6 bits (83), Expect = 0.069 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = -3 Query: 652 SASRGLVSSNATVVDERVLGDCLNEITR 569 S SR L S+A VVDE VL +CLNEI R Sbjct: 9 SISRALAMSSAAVVDESVLRECLNEIAR 36
>SR542_ARATH (P49966) Signal recognition particle 54 kDa protein 2 (SRP54)| Length = 495 Score = 35.0 bits (79), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -3 Query: 628 SNATVVDERVLGDCLNEITR 569 +N T++DE+ L DCLNEITR Sbjct: 18 NNVTIIDEKALNDCLNEITR 37
>SR543_ARATH (P49967) Signal recognition particle 54 kDa protein 3 (SRP54)| Length = 495 Score = 34.7 bits (78), Expect = 0.26 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -3 Query: 628 SNATVVDERVLGDCLNEITR 569 SN T++DE+ L +CLNEITR Sbjct: 18 SNVTIIDEKALNECLNEITR 37
>SR541_ARATH (P37106) Signal recognition particle 54 kDa protein 1 (SRP54)| Length = 479 Score = 32.3 bits (72), Expect = 1.3 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -3 Query: 628 SNATVVDERVLGDCLNEITR 569 +N T++DE+VL D LNEITR Sbjct: 18 NNVTIIDEKVLNDFLNEITR 37
>HS101_ORYSA (Q6F2Y7) Heat shock protein 101| Length = 912 Score = 31.6 bits (70), Expect = 2.2 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 391 KGASARAVARLIIRHLQ*QMCSDCLALSGVSSAQLIGRLVKLK 519 +G S AV +L++ L+ + SDCL +GVS+A++ L KL+ Sbjct: 105 RGDSHLAVDQLLLGLLEDSLISDCLKEAGVSAARVRAELEKLR 147
>KCND1_HUMAN (Q9NSA2) Potassium voltage-gated channel subfamily D member 1| (Voltage-gated potassium channel subunit Kv4.1) Length = 647 Score = 30.8 bits (68), Expect = 3.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 250 MLSPWRRPHRPQQRSRLTPPSHGQRHVNADPRRLVTTL 137 ML+ RR H PQ RS L H +N D R V + Sbjct: 561 MLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAI 598
>DOT1L_DROME (Q8INR6) Histone-lysine N-methyltransferase, H3 lysine-79 specific| (EC 2.1.1.43) (Histone H3-K79 methyltransferase) (H3-K79-HMTase) (Protein grappa) (DOT1-like protein) (dDOT1L) Length = 1848 Score = 29.6 bits (65), Expect = 8.4 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 259 RSTMLSPWRRPHRPQQRSRLTPPSHGQRHVNA 164 RS+ L+P ++P RP + + PP+ Q+H +A Sbjct: 1635 RSSPLAPHQQPPRPSKLAHYEPPTTQQQHAHA 1666 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,059,869 Number of Sequences: 219361 Number of extensions: 1604158 Number of successful extensions: 4206 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4206 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)