| Clone Name | rbasd22o11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNZ1_HUMAN (Q9H777) Zinc phosphodiesterase ELAC protein 1 (EC 3.... | 32 | 1.1 | 2 | RNZ1_MOUSE (Q8VEB6) Zinc phosphodiesterase ELAC protein 1 (EC 3.... | 32 | 1.1 | 3 | SPS_SOLTU (Q43845) Sucrose-phosphate synthase (EC 2.4.1.14) (UDP... | 30 | 5.6 |
|---|
>RNZ1_HUMAN (Q9H777) Zinc phosphodiesterase ELAC protein 1 (EC 3.1.26.11)| (Ribonuclease Z 1) (RNase Z 1) (tRNase Z 1) (tRNA 3 endonuclease 1) (ElaC homolog protein 1) (Deleted in Ma29) Length = 363 Score = 32.0 bits (71), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 343 PTSKATCIILLCQVECHDFDCSNGART 423 PT A+ ++L C+ EC FDC G +T Sbjct: 17 PTRGASAVVLRCEGECWLFDCGEGTQT 43
>RNZ1_MOUSE (Q8VEB6) Zinc phosphodiesterase ELAC protein 1 (EC 3.1.26.11)| (Ribonuclease Z 1) (RNase Z 1) (tRNase Z 1) (tRNA 3 endonuclease 1) (ElaC homolog protein 1) Length = 362 Score = 32.0 bits (71), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 343 PTSKATCIILLCQVECHDFDCSNGART 423 PT A+ ++L C+ EC FDC G +T Sbjct: 17 PTRGASAVVLRCEGECWLFDCGEGTQT 43
>SPS_SOLTU (Q43845) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1053 Score = 29.6 bits (65), Expect = 5.6 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 325 CKPSYDPTSKATCIILLCQ-VECHDFDCSNGARTNNCP 435 CKP P SK ++ Q + CH C NG+R N P Sbjct: 914 CKPGTVPPSKELRKVMRIQALRCHAVYCQNGSRINVIP 951 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,900,893 Number of Sequences: 219361 Number of extensions: 1464314 Number of successful extensions: 2992 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2990 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)