| Clone Name | rbasd23c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SV2A_RAT (Q02563) Synaptic vesicle protein 2a (SV2) | 32 | 1.2 | 2 | ETF2_FOWPV (Q9J562) Early transcription factor 82 kDa subunit (V... | 29 | 8.1 |
|---|
>SV2A_RAT (Q02563) Synaptic vesicle protein 2a (SV2)| Length = 742 Score = 31.6 bits (70), Expect = 1.2 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 10/78 (12%) Frame = +2 Query: 110 FSFHS*KVY-LGFYWPNSSNIIVLLGELSS---------HDQVWRVLRLLHIPNSMLKLA 259 + FHS +V+ L F +P+ I L + S HD+ W VL+ +H N K Sbjct: 328 YQFHSWRVFVLVFAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAK-G 386 Query: 260 SPERKL*LLFIKSNHEQN 313 PER + IK+ H+++ Sbjct: 387 HPERVFSVTHIKTIHQED 404
>ETF2_FOWPV (Q9J562) Early transcription factor 82 kDa subunit (VETF large| subunit) Length = 709 Score = 28.9 bits (63), Expect = 8.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 273 NCNYYSLKATMSRTDIVLFGNLKHI 347 NC YY+LK ++ DI+ F N +++ Sbjct: 524 NCRYYTLKRIRTKNDIIQFVNTENV 548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,047,810 Number of Sequences: 219361 Number of extensions: 1060927 Number of successful extensions: 1950 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1950 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)