| Clone Name | rbasd22n05 |
|---|---|
| Clone Library Name | barley_pub |
>YJK8_YEAST (P42946) Hypothetical 41.5 kDa protein in GZF3-IME2 intergenic| region Length = 383 Score = 30.4 bits (67), Expect = 1.7 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = -1 Query: 386 IPPGIQSTDALLSAHQSGNRCRNCNL*SVSQSVHDPSS 273 +P GI S ++LLS QS N N N +++ S DPSS Sbjct: 308 VPSGIASQNSLLSGLQSANTIVNANE-TITTSTSDPSS 344
>POLG_HCV6A (Q5I2N3) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 29.6 bits (65), Expect = 2.9 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -2 Query: 391 DRSLPEFSPRMLCSLLISQVTDVVIVTCNQS----VSQSMIHHHQCSVDVRVCVSISQSV 224 DR E SP L+ T + I+ C+ S +S +IH HQ VDV+ +S SV Sbjct: 660 DRDRIEMSP------LLFSTTQLAILPCSFSTMPALSTGLIHLHQNIVDVQYLYGVSSSV 713
>POLG_HCVJL (Q68798) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3021 Score = 29.3 bits (64), Expect = 3.8 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Frame = -2 Query: 394 SDRSLPEFSPRMLCSLLISQVTDVVIVTCN----QSVSQSMIHHHQCSVDVRVCVSISQS 227 +DR E SP L+ T++ I+ C+ ++S +IH HQ VDV+ +S S Sbjct: 658 ADRDRIEMSP------LLFSTTELAILPCSFTTMPALSTGLIHLHQNVVDVQYLYGLSTS 711 Query: 226 V 224 + Sbjct: 712 I 712
>PEX13_HUMAN (Q92968) Peroxisomal membrane protein PEX13 (Peroxin-13)| Length = 403 Score = 29.3 bits (64), Expect = 3.8 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -1 Query: 143 GKKKTSNKKNRVAESVCSVLCMYCDTTAAVTSKSWP 36 G ++ S ++ AES +V C+ + AA ++KSWP Sbjct: 200 GLRRGSENEDLWAESEGTVACLGAEDRAATSAKSWP 235
>POLG_HCVBK (P26663) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.9 bits (63), Expect = 5.0 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = -2 Query: 391 DRSLPEFSPRMLCSLLISQVTDVVIVTCN----QSVSQSMIHHHQCSVDVRVCVSISQSV 224 DR PE SP +L + T+ ++ C+ ++S +IH HQ VDV+ I +V Sbjct: 655 DRDRPELSPLLLST------TEWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGIGSAV 708
>POLG_HCVT5 (O92529) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 28.9 bits (63), Expect = 5.0 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -2 Query: 391 DRSLPEFSPRMLCSLLISQVTDVVIVTCN----QSVSQSMIHHHQCSVDVRVCVSISQSV 224 DR E SP L+ T + I+ C+ ++S +IH HQ VDV+ +S S+ Sbjct: 660 DRDRIEMSP------LLFSTTQLAILPCSFTTMPALSTGLIHLHQNIVDVQYLYGVSSSI 713
>ECM2_HUMAN (O94769) Extracellular matrix protein 2 precursor (Matrix| glycoprotein SC1/ECM2) Length = 699 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 404 HGDQ*SIPPGIQSTDALLSAHQSGNRCRN 318 H D SIPPGIQ AL + N+ RN Sbjct: 617 HNDLKSIPPGIQEMKALHFLRLNNNKIRN 645 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,324,487 Number of Sequences: 219361 Number of extensions: 841316 Number of successful extensions: 1761 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1756 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)