| Clone Name | rbasd23b20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRYB1_RAT (P27435) Tryptase precursor (EC 3.4.21.59) (Mast cell ... | 33 | 0.68 | 2 | C76C2_ARATH (O64637) Cytochrome P450 76C2 (EC 1.14.-.-) | 31 | 2.0 | 3 | TERT_HUMAN (O14746) Telomerase reverse transcriptase (EC 2.7.7.4... | 30 | 3.4 |
|---|
>TRYB1_RAT (P27435) Tryptase precursor (EC 3.4.21.59) (Mast cell protease 7)| (MMCP-7) (Tryptase alpha/beta-1) (Tryptase, skin) Length = 273 Score = 32.7 bits (73), Expect = 0.68 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +3 Query: 183 TLPPTTKKWRTSAANSSSTLSIAQPFPFEEQR---SANLLCSMKNYLSLN 323 T P T W T N ++ +S+ PFP EE + N LC +K + LN Sbjct: 146 TFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLN 195
>C76C2_ARATH (O64637) Cytochrome P450 76C2 (EC 1.14.-.-)| Length = 512 Score = 31.2 bits (69), Expect = 2.0 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 1/95 (1%) Frame = +3 Query: 36 GSLKTLLV*C*QLQEPEKQQPALETNRQVTSGSTN*HCTERLNGEK-NLNTLPPTTKKWR 212 GSL T++V PE + L T Q+ S T + +N +K ++ LPP++ +WR Sbjct: 78 GSLNTVVV-----TSPEAAREVLRTYDQILSSRTPTNSIRSINHDKVSVVWLPPSSSRWR 132 Query: 213 TSAANSSSTLSIAQPFPFEEQRSANLLCSMKNYLS 317 S++ L Q + N + + +++S Sbjct: 133 LLRKLSATQLFSPQRIEATKTLRENKVKELVSFMS 167
>TERT_HUMAN (O14746) Telomerase reverse transcriptase (EC 2.7.7.49) (Telomerase| catalytic subunit) (HEST2) (Telomerase-associated protein 2) (TP2) Length = 1132 Score = 30.4 bits (67), Expect = 3.4 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 3/95 (3%) Frame = +1 Query: 226 TQAQPFPLLNPFHLRSNAALTCCAV*KTISLLTSCTAILLEYSLRRMWHHR*KIRGES*G 405 T QP+ HL+ + L V + S L ++ L + LR M HH +IRG+S Sbjct: 767 TDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYV 826 Query: 406 SIAG-SLGQQIATAPCKPRLLWG*LXND--SGARR 501 G G ++T C L +G + N +G RR Sbjct: 827 QCQGIPQGSILSTLLCS--LCYGDMENKLFAGIRR 859 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,110,172 Number of Sequences: 219361 Number of extensions: 1170191 Number of successful extensions: 2634 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2633 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)